PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.339230.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 211aa MW: 23710.9 Da PI: 10.2942 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55 | 1.8e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg WT+eEd +++ +v +G g+W++++++ g++R++k+c++rw +yl Cucsa.339230.1 14 RGLWTAEEDAKILAYVSNHGVGNWTLVPKKAGLNRCGKSCRLRWTNYL 61 788*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.8 | 1.6e-15 | 69 | 110 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 ++T++E++l++++++ G++ W+ Ia+ ++ gRt++++k++w++ Cucsa.339230.1 69 SFTPQEEDLIIKLHQAIGSR-WSVIAKQLP-GRTDNDVKNYWNT 110 79******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.9E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.293 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.52E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.2E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.62E-12 | 17 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 9.7E-25 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.4E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 17.612 | 66 | 116 | IPR017930 | Myb domain |
CDD | cd00167 | 2.40E-11 | 69 | 112 | No hit | No description |
Pfam | PF00249 | 1.7E-14 | 69 | 110 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0048658 | Biological Process | anther wall tapetum development | ||||
GO:0052545 | Biological Process | callose localization | ||||
GO:0055046 | Biological Process | microgametogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 211 aa Download sequence Send to blast |
MGKPPCCDKS NVKRGLWTAE EDAKILAYVS NHGVGNWTLV PKKAGLNRCG KSCRLRWTNY 60 LRPDLRHDSF TPQEEDLIIK LHQAIGSRWS VIAKQLPGRT DNDVKNYWNT KLRKKLLKMG 120 IDPITHKPFS QILFDYGSIS SLQTTPKPLM GPFNKTLTPT TTMAKSQQPF SSGTNMGEQF 180 QFQTPKKPYI LKEQPTSSSC SSSSINGSET X |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-29 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Required for anther development and early tapetal function during microspore maturation (PubMed:18397379, PubMed:21957980). Regulates callose dissolution required for microspores release from the tetrads (PubMed:18397379). {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681841 | 1e-171 | LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011. | |||
GenBank | LN713258 | 1e-171 | LN713258.1 Cucumis melo genomic chromosome, chr_4. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004147487.1 | 1e-156 | PREDICTED: myb-related protein Zm38 | ||||
Swissprot | Q9LSI7 | 3e-78 | MYB35_ARATH; Transcription factor MYB35 | ||||
TrEMBL | A0A1S3B843 | 1e-144 | A0A1S3B843_CUCME; transcription factor MYB35 | ||||
STRING | XP_004147487.1 | 1e-155 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2942 | 34 | 74 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28470.1 | 2e-80 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.339230.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|