PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G28470.1 | ||||||||
Common Name | ATMYB35, MFJ20.16, MYB35, TDF1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 317aa MW: 35812.9 Da PI: 6.985 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.4 | 3.2e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd +++ +v+ +G g+W++I+++ g++R++k+c++rw +yl AT3G28470.1 14 KGLWTEEEDAKILAYVAIHGVGNWSLIPKKAGLNRCGKSCRLRWTNYL 61 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.6 | 2.2e-16 | 69 | 110 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +++t+E+el++++++ G++ W++Iar+++ gRt++++k++w++ AT3G28470.1 69 SFSTQEEELIIECHRAIGSR-WSSIARKLP-GRTDNDVKNHWNT 110 79******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.7E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 27.917 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.26E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-16 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.98E-13 | 17 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-22 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.1E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.735 | 66 | 116 | IPR017930 | Myb domain |
CDD | cd00167 | 3.27E-10 | 69 | 110 | No hit | No description |
Pfam | PF00249 | 5.1E-14 | 69 | 110 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0048658 | Biological Process | anther wall tapetum development | ||||
GO:0052545 | Biological Process | callose localization | ||||
GO:0055046 | Biological Process | microgametogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009049 | anatomy | inflorescence | ||||
PO:0009071 | anatomy | anther wall tapetum | ||||
PO:0020047 | anatomy | microsporocyte | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 317 aa Download sequence Send to blast |
MGRPPCCDKS NVKKGLWTEE EDAKILAYVA IHGVGNWSLI PKKAGLNRCG KSCRLRWTNY 60 LRPDLKHDSF STQEEELIIE CHRAIGSRWS SIARKLPGRT DNDVKNHWNT KLKKKLMKMG 120 IDPVTHKPVS QLLAEFRNIS GHGNASFKTE PSNNSILTQS NSAWEMMRNT TTNHESYYTN 180 SPMMFTNSSE YQTTPFHFYS HPNHLLNGTT SSCSSSSSST SITQPNQVPQ TPVTNFYWSD 240 FLLSDPVPQV VGSSATSDLT FTQNEHHFNI EAEYISQNID SKASGTCHSA SSFVDEILDK 300 DQEMLSQFPQ LLNDFDY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-29 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30689209 | 0.0 | ||||
Genevisible | 257904_at | 0.0 | ||||
Expression Atlas | AT3G28470 | - | ||||
AtGenExpress | AT3G28470 | - | ||||
ATTED-II | AT3G28470 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During anther development, first confined to meiocytes, tapetal and middle layer cells. At the microspore stage, mainly expressed in the tapetum and microspores. Later observed in developing pollen grains. {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}. | |||||
Uniprot | TISSUE SPECIFICITY: Inflorescences-specific (PubMed:18397379). Accumulates in anthers, especially in tapetum and meiocytes/microsporocytes and microspores during anther development (PubMed:17666023, PubMed:18397379). {ECO:0000269|PubMed:17666023, ECO:0000269|PubMed:18397379}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Member of the R2R3 factor gene family. | |||||
UniProt | Required for anther development and early tapetal function during microspore maturation (PubMed:18397379, PubMed:21957980). Regulates callose dissolution required for microspores release from the tetrads (PubMed:18397379). {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G28470.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator (A: Activate/R: Repress) | |||||
ATRM | AT4G21330 (A) |
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Target Gene (A: Activate/R: Repress) | |||||
ATRM | AT5G56110(A) |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | Brassinosteroid |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: Male-sterile mutant, defective in tapetal development, characterized by irregular and excessive division, redundant cells and leading to dysfunction of the tapetum (PubMed:18397379, PubMed:21957980). Impaired callose dissolution resulting in altered microspores release from the tetrads and no pollen production (PubMed:18397379). {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G28470 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519591 | 0.0 | AY519591.1 Arabidopsis thaliana MYB transcription factor (At3g28470) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_189488.1 | 0.0 | Duplicated homeodomain-like superfamily protein | ||||
Swissprot | Q9LSI7 | 0.0 | MYB35_ARATH; Transcription factor MYB35 | ||||
TrEMBL | A0A178VQ25 | 0.0 | A0A178VQ25_ARATH; TDF1 | ||||
STRING | AT3G28470.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G28470.1 |
Entrez Gene | 822477 |
iHOP | AT3G28470 |
wikigenes | AT3G28470 |