PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.302640.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 184aa MW: 21464.1 Da PI: 9.395 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.9 | 8.3e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye+s+ Cucsa.302640.2 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSN 59 79***********************************************95 PP | |||||||
2 | K-box | 69.6 | 1e-23 | 89 | 172 | 17 | 98 |
K-box 17 lqqela..kLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 l++e++ + k++e L+ +R+llG++L+ +s+ eLqqLe+qLe+sl+kiRs+K+++l+++i +l++ ek+l een aL+ k+ Cucsa.302640.2 89 LEKEYDsfSMTKKLEHLEVCKRKLLGDGLDLCSIDELQQLERQLERSLSKIRSRKYQMLKDEIMKLKEEEKMLLEENAALQIKV 172 44444422689*********************************************************************9886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.286 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.75E-33 | 3 | 81 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.17E-42 | 3 | 78 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.8E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.202 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.3E-22 | 89 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010048 | Biological Process | vernalization response | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP RGKLYEFSNC 60 SMNKTIDRYQ NRTKDLMSSN STAIEDVQLE KEYDSFSMTK KLEHLEVCKR KLLGDGLDLC 120 SIDELQQLER QLERSLSKIR SRKYQMLKDE IMKLKEEEKM LLEENAALQI KVIQYMLSLL 180 FFS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 9e-19 | 1 | 84 | 1 | 84 | MEF2 CHIMERA |
6bz1_B | 9e-19 | 1 | 84 | 1 | 84 | MEF2 CHIMERA |
6bz1_C | 9e-19 | 1 | 84 | 1 | 84 | MEF2 CHIMERA |
6bz1_D | 9e-19 | 1 | 84 | 1 | 84 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681895 | 3e-94 | LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005. | |||
GenBank | LN713263 | 3e-94 | LN713263.1 Cucumis melo genomic chromosome, chr_9. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011654776.1 | 1e-122 | PREDICTED: agamous-like MADS-box protein AGL19 | ||||
Swissprot | O82743 | 1e-72 | AGL19_ARATH; Agamous-like MADS-box protein AGL19 | ||||
TrEMBL | A0A1S3AT26 | 1e-117 | A0A1S3AT26_CUCME; agamous-like MADS-box protein AGL19 | ||||
STRING | XP_004143998.1 | 1e-121 | (Cucumis sativus) | ||||
STRING | XP_004166995.1 | 1e-121 | (Cucumis sativus) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45660.1 | 4e-57 | AGAMOUS-like 20 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.302640.2 |
Publications ? help Back to Top | |||
---|---|---|---|
|