PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.302100.1 | ||||||||
Common Name | Csa_5G160210, LOC101214748 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 249aa MW: 27438.9 Da PI: 8.4194 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 229.2 | 1e-70 | 41 | 208 | 3 | 170 |
YABBY 3 vfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaae.shldeslkee...lleelkveeenlksnvekeesas 93 + ss+eq+Cyv+Cn C+t+lavsvP slfk+vtvrCGhCt+ll vn++ + + ++l++s+ + +le++ + ++n+ n+ Cucsa.302100.1 41 LPSSPEQLCYVHCNICDTVLAVSVPCCSLFKTVTVRCGHCTNLLPVNMRGLLLPSPNQfHQLGHSFFSPshnILENMATPNSNYLINQFGA---- 131 56899****************************************8877766555544244666665553335555554444444443332.... PP YABBY 94 tsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 t+++ + s+ ++e+pr+p v+rPPekrqrvPsaynrfik+eiqrik+ nPdishreafsaaaknWahfP+ihfgl Cucsa.302100.1 132 TTNNFGMPSRGVTDELPRPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHFPHIHFGL 208 22333334788999*************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 9.6E-70 | 44 | 208 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.31E-7 | 152 | 201 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 3.0E-4 | 156 | 202 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0009933 | Biological Process | meristem structural organization | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0010154 | Biological Process | fruit development | ||||
GO:0010158 | Biological Process | abaxial cell fate specification | ||||
GO:0010159 | Biological Process | specification of organ position | ||||
GO:0010450 | Biological Process | inflorescence meristem growth | ||||
GO:1902183 | Biological Process | regulation of shoot apical meristem development | ||||
GO:2000024 | Biological Process | regulation of leaf development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MSSSSCSSSS PTSTTTTATT TTTTTTTTLL SQQQQLLDHH LPSSPEQLCY VHCNICDTVL 60 AVSVPCCSLF KTVTVRCGHC TNLLPVNMRG LLLPSPNQFH QLGHSFFSPS HNILENMATP 120 NSNYLINQFG ATTNNFGMPS RGVTDELPRP PVVNRPPEKR QRVPSAYNRF IKDEIQRIKS 180 VNPDISHREA FSAAAKNWAH FPHIHFGLMP DQTVKKTNIR QQEQGDAQNV LMKDNGFYAS 240 ANVGVTHF* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269|PubMed:10323860, ECO:0000269|PubMed:10331982, ECO:0000269|PubMed:10457020, ECO:0000269|PubMed:11812777, ECO:0000269|PubMed:12417699, ECO:0000269|PubMed:19837869, ECO:0000269|PubMed:9878633, ECO:0000269|Ref.3, ECO:0000269|Ref.6}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00620 | PBM | Transfer from AT2G45190 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681895 | 7e-96 | LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005. | |||
GenBank | LN713263 | 7e-96 | LN713263.1 Cucumis melo genomic chromosome, chr_9. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004147586.1 | 0.0 | PREDICTED: axial regulator YABBY 5-like | ||||
Swissprot | O22152 | 2e-76 | YAB1_ARATH; Axial regulator YABBY 1 | ||||
TrEMBL | A0A0A0KKT0 | 0.0 | A0A0A0KKT0_CUCSA; Axial regulator YABBY1 | ||||
STRING | XP_004147586.1 | 0.0 | (Cucumis sativus) | ||||
STRING | XP_004167326.1 | 0.0 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2040 | 34 | 90 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45190.1 | 1e-77 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.302100.1 |
Entrez Gene | 101214748 |