PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.201970.1 | ||||||||
Common Name | Csa_5G139610, TRY | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 83aa MW: 9835.25 Da PI: 9.9414 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.6 | 1.4e-08 | 30 | 69 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+ + +k+ G + W++Ia +++ gR ++++ +w Cucsa.201970.1 30 MTAQEEDLIHRMHKLIGDR-WDLIAGRIP-GRKPEEIERYWI 69 69***************99.*********.***********6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 8.4E-6 | 26 | 74 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.33E-6 | 29 | 68 | No hit | No description |
Pfam | PF00249 | 1.6E-7 | 30 | 69 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.4E-11 | 31 | 69 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 8.58E-8 | 31 | 70 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010091 | Biological Process | trichome branching | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
MDNHRHQKPA KISPLESEEV SSTRWQFITM TAQEEDLIHR MHKLIGDRWD LIAGRIPGRK 60 PEEIERYWIM THLEGFGKRR RG* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JN255699 | 1e-137 | JN255699.1 Cucumis sativus R3 MYB transcription factor (TRY) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004145923.1 | 6e-55 | PREDICTED: transcription factor TRY | ||||
Refseq | XP_011654628.1 | 6e-55 | PREDICTED: transcription factor TRY | ||||
Swissprot | Q8GV05 | 1e-32 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | I6NF75 | 1e-53 | I6NF75_CUCSA; R3 MYB transcription factor | ||||
STRING | XP_004145923.1 | 2e-54 | (Cucumis sativus) | ||||
STRING | XP_004160369.1 | 2e-54 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3583 | 27 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 5e-35 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.201970.1 |
Entrez Gene | 101221077 |