PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.123440.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 186aa MW: 20747.1 Da PI: 10.4348 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.8 | 6.1e-19 | 13 | 58 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd +l ++v+++G+++W++I+r++ gR++k+c++rw + Cucsa.123440.1 13 KGPWSAEEDRILTRLVERYGPRNWSLISRYVK-GRSGKSCRLRWCNQ 58 79*****************************9.***********985 PP | |||||||
2 | Myb_DNA-binding | 54.4 | 2.8e-17 | 67 | 109 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++ Ed+ +v a+ ++G++ W+tIar ++ gRt++ +k++w++ Cucsa.123440.1 67 PFSPAEDDAIVAAHSRYGNR-WATIARLLP-GRTDNAVKNHWNST 109 79******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.411 | 8 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.56E-32 | 10 | 106 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.5E-15 | 12 | 61 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.1E-18 | 13 | 58 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-23 | 14 | 66 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.38E-14 | 15 | 57 | No hit | No description |
SMART | SM00717 | 6.9E-15 | 64 | 112 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.719 | 65 | 114 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.4E-22 | 67 | 113 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.10E-10 | 67 | 110 | No hit | No description |
Pfam | PF00249 | 3.9E-14 | 67 | 109 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
PPPSSSPIPD KIKGPWSAEE DRILTRLVER YGPRNWSLIS RYVKGRSGKS CRLRWCNQLC 60 PGVEHRPFSP AEDDAIVAAH SRYGNRWATI ARLLPGRTDN AVKNHWNSTL KRRVRDDRRN 120 SSSNHTSDVV GGGGNVGGGG GEVVRESDRR SENLPAGFWE VMKDVVAREV REYMTTTFSE 180 NRGFG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-42 | 8 | 114 | 2 | 108 | B-MYB |
1h88_C | 2e-41 | 9 | 114 | 54 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 2e-41 | 9 | 114 | 54 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681861 | 0.0 | LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029. | |||
GenBank | LN713261 | 0.0 | LN713261.1 Cucumis melo genomic chromosome, chr_7. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008452503.1 | 1e-117 | PREDICTED: transcriptional activator Myb-like | ||||
Swissprot | Q9SN12 | 5e-54 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A1S3BV53 | 1e-115 | A0A1S3BV53_CUCME; transcriptional activator Myb-like | ||||
STRING | XP_008452503.1 | 1e-116 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5074 | 32 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 2e-55 | myb domain protein 77 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.123440.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|