PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK21422.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 114aa MW: 12313 Da PI: 8.3982 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 105.1 | 4.5e-33 | 32 | 87 | 3 | 59 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 +vrY eC+kNhAa +Gg+avDGC+Efm+s g egt+aal+CaACgCHRnFHRre+++ PK21422.1 32 SVRYGECQKNHAAGVGGYAVDGCREFMAS-GVEGTTAALTCAACGCHRNFHRREPDQ 87 79**************************9.999*********************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04770 | 2.1E-30 | 33 | 85 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 7.0E-27 | 34 | 84 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 3.0E-12 | 35 | 86 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.573 | 35 | 84 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
IKLIIIVVVV MRKRQVVVRR EEVSRSMGVV MSVRYGECQK NHAAGVGGYA VDGCREFMAS 60 GVEGTTAALT CAACGCHRNF HRREPDQTPS TTTSHHHHEV VCDSSSSPSS SNGL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021889716.1 | 4e-43 | mini zinc finger protein 2 | ||||
Swissprot | Q9LJW5 | 6e-35 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A061EGD2 | 1e-39 | A0A061EGD2_THECC; Mini zinc finger 2 isoform 2 (Fragment) | ||||
TrEMBL | A0A1R3GV65 | 5e-40 | A0A1R3GV65_9ROSI; Uncharacterized protein | ||||
STRING | evm.model.supercontig_140.56 | 1e-42 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74660.1 | 9e-18 | mini zinc finger 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|