PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK21020.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 73aa MW: 8456.43 Da PI: 8.9183 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 55 | 1.6e-17 | 3 | 69 | 290 | 358 |
GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358 +++ei+n+va eg +r+erhe++ +Wr++l++aGF+ + l k +qa+++l+ ++ dgy++ +e+g+l PK21020.1 3 FAEEIRNIVAFEGPSRIERHERVDQWRRQLGRAGFQVLGL--KCLSQARMMLSVYGCDGYTLSSEKGCL 69 899*********************************9887..589**********************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 10.425 | 1 | 67 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 5.7E-15 | 3 | 69 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 73 aa Download sequence Send to blast |
HHFAEEIRNI VAFEGPSRIE RHERVDQWRR QLGRAGFQVL GLKCLSQARM MLSVYGCDGY 60 TLSSEKGCLD RKX |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that functions in mycorrhizal specific signaling (PubMed:23122845). Required for Myc factor signaling from mycorrhizal fungi, but has no function in Nod factor signaling from rhizobial bacteria (PubMed:23122845). Regulates the expression of RAM2, a glycerol-3-phosphate acyl transferase that promotes cutin biosynthesis to enhance mycorrhizal hyphopodia formation (PubMed:23122845). {ECO:0000269|PubMed:23122845}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced in roots during colonization by arbuscular mycorrhizal fungi. {ECO:0000269|PubMed:23122845}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010089231.1 | 9e-39 | DELLA protein RGL1 | ||||
Swissprot | G7L166 | 2e-18 | RAM1_MEDTR; GRAS family protein RAM1 | ||||
TrEMBL | W9QHI8 | 2e-37 | W9QHI8_9ROSA; Uncharacterized protein | ||||
STRING | XP_010089231.1 | 3e-38 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF25556 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14920.1 | 2e-15 | GRAS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|