PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK20894.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 124aa MW: 14535.9 Da PI: 10.1554 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 105.3 | 3.2e-33 | 43 | 101 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s +prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+ PK20894.1 43 LDDGYRWRKYGQKAVKNSAYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 101 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 8.0E-34 | 29 | 101 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.75E-29 | 36 | 102 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.057 | 38 | 103 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.6E-38 | 43 | 102 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.6E-26 | 44 | 101 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
EDHNNNNNNE EDNQSNKRRA PGKSRKTARP RFAFQTRSAD DILDDGYRWR KYGQKAVKNS 60 AYPRSYYRCT HHTCNVKKQV QRLSKDTSIV VTTYEGIHNH PCEKLMETLT PLLRQMQFLS 120 ASNX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-26 | 33 | 100 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-26 | 33 | 100 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP229736 | 1e-77 | KP229736.1 UNVERIFIED: Boehmeria nivea WRKY transcription factor-like (WRKY07) mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010112967.2 | 1e-74 | probable WRKY transcription factor 43 | ||||
Swissprot | Q8VWQ4 | 3e-56 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
TrEMBL | W9SMI0 | 6e-72 | W9SMI0_9ROSA; Putative WRKY transcription factor 56 | ||||
STRING | XP_010112967.1 | 1e-72 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3227 | 34 | 71 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G64000.1 | 1e-58 | WRKY DNA-binding protein 56 |