PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK18657.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 153aa MW: 17278.9 Da PI: 11.1586 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 57.5 | 1.8e-18 | 73 | 107 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++Cg+ kTp+WR gp g+ktLCnaCG++y++ +l PK18657.1 73 CQHCGAEKTPQWRAGPCGPKTLCNACGVRYKSGRL 107 *******************************9885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 3.7E-15 | 67 | 117 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.09E-14 | 69 | 130 | No hit | No description |
PROSITE profile | PS50114 | 11.873 | 70 | 103 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 1.9E-14 | 71 | 105 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 2.43E-13 | 72 | 120 | No hit | No description |
Pfam | PF00320 | 4.4E-16 | 73 | 107 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 73 | 98 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007623 | Biological Process | circadian rhythm | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
XRSKRRCRRR RGSYFDMSGE KLFLSIGNCH HSVKTEKKKK KRKKAMKKDN KTTTMTLMTS 60 AAKMSGGIMG RKCQHCGAEK TPQWRAGPCG PKTLCNACGV RYKSGRLVPE YRPASSPSFS 120 SDLHSNSHRK IIEMRKGKNV VGMMVENHNP IES |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 36 | 47 | KKKKKRKKAMKK |
2 | 37 | 42 | KKKKRK |
3 | 37 | 43 | KKKKRKK |
4 | 39 | 43 | KKRKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00377 | DAP | Transfer from AT3G24050 | Download |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021595256.1 | 6e-44 | GATA transcription factor 1-like | ||||
Swissprot | Q8LAU9 | 7e-43 | GATA1_ARATH; GATA transcription factor 1 | ||||
TrEMBL | A0A2C9UD00 | 1e-42 | A0A2C9UD00_MANES; Uncharacterized protein | ||||
TrEMBL | A0A2P5EHJ6 | 2e-42 | A0A2P5EHJ6_TREOI; GATA transcription factor | ||||
STRING | cassava4.1_014105m | 2e-43 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF8537 | 29 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24050.1 | 6e-44 | GATA transcription factor 1 |