PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK10274.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 132aa MW: 15664.5 Da PI: 9.7976 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.5 | 2.3e-16 | 10 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W +eEde+l+ v+++G ++W++ a+ g++R++k+c++rw++yl PK10274.1 10 KGTWLEEEDERLISFVQLMGEKRWDALAKASGLRRSGKSCRLRWLNYL 57 799********************************************7 PP | |||||||
2 | Myb_DNA-binding | 54.1 | 3.5e-17 | 67 | 108 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 ++eE+ +++++++++G++ W++Iar ++ gRt++++k++w++yl PK10274.1 67 SAEEENIIIQLHERWGNK-WSKIARILP-GRTDNEIKNYWRTYL 108 89****************.*********.*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.355 | 5 | 57 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.99E-28 | 8 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.3E-14 | 9 | 59 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-15 | 10 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.5E-21 | 11 | 64 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.32E-9 | 12 | 57 | No hit | No description |
PROSITE profile | PS51294 | 25.775 | 58 | 112 | IPR017930 | Myb domain |
SMART | SM00717 | 8.0E-15 | 62 | 110 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.5E-24 | 65 | 112 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.3E-15 | 67 | 108 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.60E-11 | 67 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MQGEHDQLRK GTWLEEEDER LISFVQLMGE KRWDALAKAS GLRRSGKSCR LRWLNYLRPN 60 LKHDQISAEE ENIIIQLHER WGNKWSKIAR ILPGRTDNEI KNYWRTYLRK KLAQNQEEKG 120 KEDIATTAIG DX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 3e-30 | 7 | 112 | 1 | 105 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00406 | DAP | Transfer from AT3G53200 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024023007.1 | 1e-67 | transcription factor MYB27 | ||||
Swissprot | Q9SCP1 | 1e-50 | MYB27_ARATH; Transcription factor MYB27 | ||||
TrEMBL | A0A2P5BJP9 | 5e-68 | A0A2P5BJP9_PARAD; MYB transcription factor | ||||
STRING | XP_010098805.1 | 9e-67 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13169 | 26 | 31 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53200.1 | 6e-53 | myb domain protein 27 |
Publications ? help Back to Top | |||
---|---|---|---|
|