PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK09668.1
Organism
Cannabis sativa
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family TCP
Protein Properties Length: 109aa    MW: 12191.8 Da    PI: 10.1584
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK09668.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP951.5e-2960109251
        TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWL 51 
                ++k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++tieWL
  PK09668.1  60 PPKRTSTKDRHTKVDGRGRRIRMPATCAARVFQLTRELGHKSDGETIEWL 109
                79***********************************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.2E-2464109IPR005333Transcription factor, TCP
PROSITE profilePS5136923.63366109IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MEAENGIRRP NFPLQLLEKK EDDQACSNPG YNSLAITVPV PSDPNRPGSL QVTEPSKKAP  60
PKRTSTKDRH TKVDGRGRRI RMPATCAARV FQLTRELGHK SDGETIEWL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved the regulation of plant development. Together with TCP14, modulates plant stature by promoting cell division in young internodes. Represses cell proliferation in developing leaf blade and specific floral tissues (PubMed:21668538). Together with TCP15, acts downstream of gibberellin (GA), and the stratification pathways that promote seed germination. Involved in the control of cell proliferation at the root apical meristem (RAM) by regulating the activity of CYCB1-1 (PubMed:25655823). Acts together with SPY to promote cytokinin responses that affect leaf shape and trichome development in flowers (PubMed:22267487). Involved in gynoecium and silique development. Modulates the development of the different tissues of the gynoecium through its participation in auxin and cytokinin responses. Modulates the expression of the cytokinin-responsive genes ARR7 and ARR15. May repress the expression of the auxin biosynthetic genes YUC1 and YUC4 (PubMed:26303297). Acts as negative regulator of anthocyanin accumulation under high light conditions. Modulates the expression of transcription factors involved in the induction of anthocyanin biosynthesis genes (PubMed:26574599). Transcription factor involved in the regulation of endoreduplication. Represses endoreduplication by activating the gene expression of the key cell-cycle regulators RBR1 and CYCA2-3 (PubMed:25757472). Regulates the expression of the defense gene pathogenesis-related protein 2 (PR2) in antagonism to SRFR1, a negative regulator of effector-triggered immunity (PubMed:24689742). {ECO:0000269|PubMed:21668538, ECO:0000269|PubMed:22267487, ECO:0000269|PubMed:24689742, ECO:0000269|PubMed:25655823, ECO:0000269|PubMed:25757472, ECO:0000269|PubMed:26303297, ECO:0000269|PubMed:26574599}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation with the lowest expression in the middle of the dark period (PubMed:21183706). Induced during seed imbibition (PubMed:25655823). Induced by cytokinin (PubMed:26303297). {ECO:0000269|PubMed:21183706, ECO:0000269|PubMed:25655823, ECO:0000269|PubMed:26303297}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257089.11e-48PREDICTED: transcription factor TCP15-like isoform X1
SwissprotQ9C9L21e-33TCP15_ARATH; Transcription factor TCP15
TrEMBLA0A1U7ZU403e-47A0A1U7ZU40_NELNU; transcription factor TCP15-like isoform X1
STRINGXP_010257089.15e-48(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21203280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.15e-36TCP family protein
Publications ? help Back to Top
  1. Steiner E, et al.
    The Putative O-Linked N-Acetylglucosamine Transferase SPINDLY Inhibits Class I TCP Proteolysis to Promote Sensitivity to Cytokinin.
    Plant Physiol., 2016. 171(2): p. 1485-94
    [PMID:27208284]
  2. Dong H, et al.
    Ubiquitylation activates a peptidase that promotes cleavage and destabilization of its activating E3 ligases and diverse growth regulatory proteins to limit cell proliferation in Arabidopsis.
    Genes Dev., 2017. 31(2): p. 197-208
    [PMID:28167503]
  3. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  4. Mazur MJ, et al.
    Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci.
    Front Plant Sci, 2017. 8: p. 2043
    [PMID:29250092]