PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK08631.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 100aa MW: 11529.7 Da PI: 10.8999 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.1 | 1.8e-17 | 8 | 54 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g WT+eEd++l+++++++G+ W + a g++R++k+c++rw +yl PK08631.1 8 GFWTAEEDQKLAQVIQLHGPTKWQSLAINAGLNRSGKSCRLRWMNYL 54 67*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 41.4 | 3.3e-13 | 60 | 99 | 1 | 42 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k+ PK08631.1 60 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKN 99 78999*****************.*********.*******97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.027 | 2 | 58 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.51E-28 | 6 | 99 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-13 | 6 | 56 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.92E-11 | 10 | 54 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.1E-23 | 10 | 61 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.5E-16 | 10 | 54 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 14.976 | 59 | 100 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-4 | 59 | 100 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-11 | 60 | 99 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.9E-20 | 62 | 100 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.06E-7 | 64 | 99 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
XKEGNRSGFW TAEEDQKLAQ VIQLHGPTKW QSLAINAGLN RSGKSCRLRW MNYLRPNIKR 60 GNISDQEEDL ILRLHKLLGN RWSLIAGRLP GRTDNEIKNX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-25 | 8 | 99 | 5 | 95 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 3e-25 | 8 | 99 | 5 | 95 | C-Myb DNA-Binding Domain |
1msf_C | 3e-25 | 8 | 99 | 5 | 95 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023885767.1 | 4e-56 | transcription factor MYB114-like | ||||
Swissprot | P10290 | 2e-44 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A2P5A9Q3 | 3e-55 | A0A2P5A9Q3_PARAD; GAMYB transcription factor | ||||
TrEMBL | A0A2P5AXK4 | 3e-55 | A0A2P5AXK4_TREOI; GAMYB transcription factor | ||||
STRING | XP_009362719.1 | 2e-55 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2148 | 32 | 88 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28110.1 | 3e-44 | myb domain protein 41 |