PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT4G28110.1

Common Name

AtMYB41, MYB41

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 282aa MW: 31651.6 Da PI: 5.9026

Description

myb domain protein 41

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT4G28110.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.5	7.4e-19	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+d+++ +G+g+W+t ++ g++R++k+c++rw +yl AT4G28110.1 14 KGPWTAEEDQKLIDYIRFHGPGNWRTLPKNAGLHRCGKSCRLRWTNYL 61 79********************************************97 PP
2	Myb_DNA-binding	54.3	3e-17	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rgr++ eE+e +++++ +G++ W++Ia++++ gRt++++k++w+++ AT4G28110.1 67 RGRFSFEEEETIIQLHSVMGNK-WSAIAARLP-GRTDNEIKNHWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	7.7E-26	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	25.842	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	8.99E-32	11	108	IPR009057	Homeodomain-like
SMART	SM00717	1.0E-15	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.4E-16	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	5.69E-13	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	7.1E-27	65	117	IPR009057	Homeodomain-like
SMART	SM00717	2.7E-16	66	114	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	21.009	66	116	IPR017930	Myb domain
Pfam	PF00249	1.6E-15	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	1.87E-12	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009737	Biological Process	response to abscisic acid
GO:0010200	Biological Process	response to chitin
GO:0016049	Biological Process	cell growth
GO:0030154	Biological Process	cell differentiation
GO:0042335	Biological Process	cuticle development
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0080091	Biological Process	regulation of raffinose metabolic process
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 282 aa Download sequence Send to blast
MGRSPCCDKN GVKKGPWTAE EDQKLIDYIR FHGPGNWRTL PKNAGLHRCG KSCRLRWTNY 60 LRPDIKRGRF SFEEEETIIQ LHSVMGNKWS AIAARLPGRT DNEIKNHWNT HIRKRLVRSG 120 IDPVTHSPRL DLLDLSSLLS ALFNQPNFSA VATHASSLLN PDVLRLASLL LPLQNPNPVY 180 PSNLDQNLQT PNTSSESSQP QAETSTVPTN YETSSLEPMN ARLDDVGLAD VLPPLSESFD 240 LDSLMSTPMS SPRQNSIEAE TNSSTFFDFG IPEDFILDDF MF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	4e-30	14	116	7	108	B-MYB
1h8a_C	7e-30	14	116	27	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30687857	0.0
Genevisible	253851_at	0.0
Expression Atlas	AT4G28110	-
AtGenExpress	AT4G28110	-
ATTED-II	AT4G28110	-

Functional Description ? help Back to Top
Source	Description
TAIR	Member of the R2R3 factor gene family. Expression is induced in response to dessication, ABA and salt treatment. Overexpression of Myb41 results in abnormal cuticle development and decreased cell expansion.
UniProt	Transcription factor involved in salt stress response. Confers tolerance to salt stress (PubMed:22575450). Involved in distinct cellular processes in response to osmotic stress, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress (PubMed:19211694). Can activate the steps necessary for aliphatic suberin synthesis and deposition of cell wall-associated suberin-like lamellae. Involved in the production of aliphatic suberin under abiotic stress conditions (PubMed:25060192). {ECO:0000269\|PubMed:19211694, ECO:0000269\|PubMed:22575450, ECO:0000269\|PubMed:25060192}.

Function -- GeneRIF ? help Back to Top
AtMyb41 is involved in distinct cellular processes, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress. [PMID: 19211694] These results indicate that the phosphorylation of MYB41 by MPK6 is required for the biological function of MYB41 in salt tolerance. [PMID: 22575450] implicate AtMYB41 in the production of aliphatic suberin under abiotic stress conditions [PMID: 25060192]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00457	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT4G28110.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress (PubMed:19211694, PubMed:25060192). Induced by osmotic stress (PubMed:19211694). Induced by abscisic acid (PubMed:25060192). {ECO:0000269\|PubMed:19211694, ECO:0000269\|PubMed:25060192}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT4G05100(R), AT5G14340(R)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT4G28110

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY519610	0.0	AY519610.1 Arabidopsis thaliana MYB transcription factor (At4g28110) mRNA, complete cds.
GenBank	BT001930	0.0	BT001930.1 Arabidopsis thaliana clone C103440 putative myb family transcription factor (At4g28110) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_194540.1	0.0	myb domain protein 41
Swissprot	Q9M0J5	0.0	MYB41_ARATH; Transcription factor MYB41
TrEMBL	A0A178V452	0.0	A0A178V452_ARATH; MYB41
STRING	AT4G28110.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT4G28110.1
Entrez Gene	828927
iHOP	AT4G28110
wikigenes	AT4G28110

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Maruyama-Nakashita A,Inoue E,Watanabe-Takahashi A,Yamaya T,Takahashi H Transcriptome profiling of sulfur-responsive genes in Arabidopsis reveals global effects of sulfur nutrition on multiple metabolic pathways. Plant Physiol., 2003. 132(2): p. 597-605 [PMID:12805590] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Libault M,Wan J,Czechowski T,Udvardi M,Stacey G Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] Cominelli E,Sala T,Calvi D,Gusmaroli G,Tonelli C Over-expression of the Arabidopsis AtMYB41 gene alters cell expansion and leaf surface permeability. Plant J., 2008. 53(1): p. 53-64 [PMID:17971045] Lippold F, et al. AtMyb41 regulates transcriptional and metabolic responses to osmotic stress in Arabidopsis. Plant Physiol., 2009. 149(4): p. 1761-72 [PMID:19211694] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Hoang MH, et al. Phosphorylation by AtMPK6 is required for the biological function of AtMYB41 in Arabidopsis. Biochem. Biophys. Res. Commun., 2012. 422(1): p. 181-6 [PMID:22575450] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Li-Beisson Y, et al. Acyl-lipid metabolism. Arabidopsis Book, 2013. 11: p. e0161 [PMID:23505340] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kosma DK, et al. AtMYB41 activates ectopic suberin synthesis and assembly in multiple plant species and cell types. Plant J., 2014. 80(2): p. 216-29 [PMID:25060192] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178]