PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10024092m | ||||||||
Common Name | CARUB_v10024092mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 200aa MW: 22312.7 Da PI: 8.9799 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 100.3 | 1.9e-31 | 97 | 153 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rakle++++ +ks+kpy+heSRh hA+rRpRg+gGrF Carubv10024092m 97 EEPVFVNAKQYHGILRRRQSRAKLEARERA-IKSKKPYMHESRHLHAIRRPRGCGGRF 153 69***************************9.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 5.0E-35 | 95 | 156 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.622 | 96 | 156 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.1E-26 | 98 | 153 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 9.8E-24 | 99 | 121 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 101 | 121 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 9.8E-24 | 130 | 153 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MTSSVHELSD KNDSTGKQER SDSQSRPPAP SGRSSESVDT NSVYSEPMAH GLYPYPDPYY 60 RSVFAQQAYL PHPYPGVQLQ LMGMQQPGVP LQCDAVEEPV FVNAKQYHGI LRRRQSRAKL 120 EARERAIKSK KPYMHESRHL HAIRRPRGCG GRFLNAKKKN GDHKEEEEEE TSDENTSEAS 180 SSLRSEKLAM AASAPNGRS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 3e-20 | 96 | 166 | 1 | 71 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10024092m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY072414 | 0.0 | AY072414.1 Arabidopsis thaliana putative CCAAT-binding transcription factor subunit (At2g34720) mRNA, complete cds. | |||
GenBank | AY114711 | 0.0 | AY114711.1 Arabidopsis thaliana putative CCAAT-binding transcription factor subunit (At2g34720) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006295021.1 | 1e-146 | nuclear transcription factor Y subunit A-4 | ||||
Refseq | XP_006295022.1 | 1e-146 | nuclear transcription factor Y subunit A-4 | ||||
Refseq | XP_023639853.1 | 1e-146 | nuclear transcription factor Y subunit A-4 | ||||
Swissprot | Q8VY64 | 1e-133 | NFYA4_ARATH; Nuclear transcription factor Y subunit A-4 | ||||
TrEMBL | R0HRJ3 | 1e-145 | R0HRJ3_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.3346s0024.1.p | 1e-146 | (Capsella grandiflora) | ||||
STRING | XP_006295021.1 | 1e-146 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4168 | 27 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34720.1 | 1e-122 | nuclear factor Y, subunit A4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10024092m |
Entrez Gene | 17888321 |
Publications ? help Back to Top | |||
---|---|---|---|
|