PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10005860m | ||||||||
Common Name | CARUB_v10005860mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 179aa MW: 19394 Da PI: 10.6175 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56.4 | 4e-18 | 36 | 70 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ Cgt+ TplWR gp g+k+LCnaCG++ rkk++ Carubv10005860m 36 CVDCGTSRTPLWRGGPAGPKSLCNACGIKSRKKRQ 70 *********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.189 | 30 | 85 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 7.6E-11 | 30 | 82 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 8.08E-12 | 31 | 69 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 9.3E-15 | 34 | 70 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.01E-10 | 35 | 69 | No hit | No description |
Pfam | PF00320 | 5.0E-16 | 36 | 70 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 36 | 61 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MSEETKTKLE SAGDLSDVDN GNCSSSGSGG DTKKTCVDCG TSRTPLWRGG PAGPKSLCNA 60 CGIKSRKKRQ AALGIRQEDN KIKNKTSSNN LNLENRNVKI GKAEAGNVKN RIIKTDSESY 120 SNTNNNNSKK NVKRVSRFLD LGFKVPAMKR SAVEKKRLWR KLGEEERAAV LLMTLSCG* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10005860m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK119021 | 1e-101 | AK119021.1 Arabidopsis thaliana At4g16141 mRNA for unknown protein, complete cds, clone: RAFL21-34-K14. | |||
GenBank | AK228025 | 1e-101 | AK228025.1 Arabidopsis thaliana mRNA for hypothetical protein, partial sequence., clone: RAFL14-54-B16. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006284629.1 | 1e-125 | GATA transcription factor 17 | ||||
Swissprot | Q9LIB5 | 2e-68 | GAT17_ARATH; GATA transcription factor 17 | ||||
TrEMBL | R0F6T5 | 1e-124 | R0F6T5_9BRAS; Uncharacterized protein | ||||
STRING | XP_006284629.1 | 1e-125 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13816 | 16 | 24 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16141.1 | 1e-75 | GATA family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10005860m |
Entrez Gene | 17880159 |
Publications ? help Back to Top | |||
---|---|---|---|
|