PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G16141.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 197aa MW: 21183.3 Da PI: 10.6666 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56.2 | 4.6e-18 | 39 | 73 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ Cgt+ TplWR gp g+k+LCnaCG++ rkk++ AT4G16141.1 39 CVDCGTSRTPLWRGGPAGPKSLCNACGIKSRKKRQ 73 *********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 1.7E-11 | 33 | 84 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.242 | 33 | 88 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 9.03E-12 | 34 | 73 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.1E-14 | 37 | 73 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 7.81E-11 | 38 | 88 | No hit | No description |
Pfam | PF00320 | 5.9E-16 | 39 | 73 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 39 | 64 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005667 | Cellular Component | transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MSMTEETKTT KLESAGDSSD VDNGNCSSSG SGGDTKKTCV DCGTSRTPLW RGGPAGPKSL 60 CNACGIKSRK KRQAALGIRQ DDIKIKSKSN NNLGLESRNV KTGKGEPVNV KIAKCEPGIV 120 KIAKGEPGNV KNKIKRDPEN SSSSNNNKKN VKRVGRFLDF GFKVPAMKRS AVEKKRLWRK 180 LGEEERAAVL LMALSCG |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.44271 | 0.0 | flower| inflorescence| root| seed |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 240255905 | 0.0 | ||||
Expression Atlas | AT4G16141 | - | ||||
AtGenExpress | AT4G16141 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G16141.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G16141 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK119021 | 0.0 | AK119021.1 Arabidopsis thaliana At4g16141 mRNA for unknown protein, complete cds, clone: RAFL21-34-K14. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_680707.4 | 1e-139 | GATA type zinc finger transcription factor family protein | ||||
Swissprot | Q9LIB5 | 2e-59 | GAT17_ARATH; GATA transcription factor 17 | ||||
TrEMBL | Q8GW81 | 1e-138 | Q8GW81_ARATH; GATA type zinc finger transcription factor family protein | ||||
STRING | AT4G16141.1 | 1e-138 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13816 | 16 | 24 | Representative plant | OGRP68 | 17 | 287 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G16141.1 |
Entrez Gene | 827301 |
iHOP | AT4G16141 |
wikigenes | AT4G16141 |