PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre16.g686100.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1907aa    MW: 191111 Da    PI: 6.584
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre16.g686100.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP85.85.3e-2732106176
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                         +Cq++gC adls +k+y+rr++vCe+h +a+vvl+sg++ rfC qCs fh l  fD  +r+Cr++L+ hn+++r++
  Cre16.g686100.t1.1  32 RCQADGCMADLSGLKRYFRRYHVCEMHIRAQVVLISGRQVRFCDQCSTFHPLAFFDGVRRTCREKLE-HNRQKRRA 106
                         6*****************************************************************7.56555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.8E-262994IPR004333Transcription factor, SBP-box
PROSITE profilePS5114123.82930107IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-2432107IPR004333Transcription factor, SBP-box
PfamPF031101.8E-2633106IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.20.1000.102.7E-5445512No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1907 aa     Download sequence    Send to blast
MDMFMHGGSP EPQGRGGYED DRAGTNELAA NRCQADGCMA DLSGLKRYFR RYHVCEMHIR  60
AQVVLISGRQ VRFCDQCSTF HPLAFFDGVR RTCREKLEHN RQKRRARKAA HGGGGGGGGG  120
GAERTTGGGG GGRPAGSGRG ARSGGAGNDD DDDGGGESEG EPGGGGSDDG GSGSGRGQAR  180
KRPPSVSSSQ QQQAAAAAQR RRMGSGPMPG SAQDLALAAA VAAAAAAGMS VASPGAGAGA  240
GPGPGAGALG LGPGYSRMGS EARTGAMPGP APGPGPRGVS PGFEGEDDEY YAGRTGHPHT  300
YTHHQHPHPQ QLPQQQQSRE GYMGGANARD SLSGGPVVAG QGGSAGAHPH PHLPAQGGPP  360
PPPPRAGLFG GPLGSAAGAN GAAAAAGLLR GGSGPGAEHL RPPLREASGV LGAPSGDGLG  420
GGGGGGGGGG GGGGGGGVLP AGLSEEEALQ RQLEELRSAI TWRQQELQQH QHQRYQHHHQ  480
QQQQHQQQHQ QQQQQHQQIG LKQEGREQEA WARGPGPGPG GDEPRWQQQQ QQQQQQARHG  540
YPAPGMGQGP GLGLGRQGAP VPAMPAIAGA ANGANGVGGV NGVRVARDGA FAPPPLDPAR  600
RRPGAPGGPP PPPHLPQHPH HHHHHHQDVE MALQEQQLLQ ELRRQQQQQQ QQQQQQQQEQ  660
QQRQQQQQQR QQQQLQEQHN MQHGHQQQLR PPPPVPGATA GWSYAHTGTR PPVEVKMEVE  720
ADVGAGGGGL GGTGGLRKEL TLGPAGFTSA GAPPPYHPQH PSPHASSPRG PLVGRSWDGR  780
GPPSDPSARP PPPPPPGVSL AGFPSDVPAR LQLPGSARGP APGAAAGRPT GDGMAAAAAA  840
VRQHQQHQYQ LHQQQQEHQQ QQQHQQQQHQ QHHQHQQQLL LAEAEAELQR QRQLQAMAAA  900
GGPMAAAMRL RAGAGLGGAW QQHQHQHPQH QHQQQQPQQQ PQPQSSRRSE DWTPLTDVPT  960
LGAALPEGLS LELSFGGAAG AAGAAGLTPL GGGGGGAAAT AGLLPSAGSL ISLPLSVLQE  1020
DSSLWSDGDL ARLMAAGSVL PPPPASATSS LYTADDDGHL RGEDGEEVEM AVAAAVGPVG  1080
PVGMVGMGMP GGALAAAAAA AVDAEAAELE LDSLAAAGAH LGHRPSFGGG GGGGGGGLHR  1140
LMALRALPSG GSSAQSLAHL ALPHQAPYAH GHGGGGAAAA YGSGGGSGGG AALAEAYSTR  1200
SEASEAPEIC LTESFKAEVL SLQRLAQAQQ GHPGPHGSEF GPQHGPHGFP GPHAGAAAAA  1260
TPNQLPPSVR LHLPPSILGR GGTSYGGGSG PGGPDGGGAV YHQHQHQPYQ LQYQHQLQQQ  1320
QRVALMQHHH QQQQYQQQHL QYRPPLQQQH QQQQQLHQQP AAAPPLFGEG RVSAFHLLGP  1380
GDLDDEEEDG PALGPGWQLH PHQHPHPQQP YGGMGRPQQQ PQQHQQPQHQ HQQQAGGLDS  1440
RPSHLAGAGF GAGTGARAGG GGAAAVASAG AGAGAGAGAP QILLLPGGPA AGSQPGRLLG  1500
SAAALGLGGA RGGGGGGGGE HTLVQPSLRR LSQQEQDGRG AQGAASADSE PPPPAQQQQM  1560
QQQQQQQQTA NGPTGKVGGG GPGAGLARAP AAPREAPQQA QQPRANGEVR HPTGAAQAWS  1620
GGVASGGPAA AADGNLGSAA AVAAVAAAAA EAEADGEVGE EEEEVDPSEL LRQAYSAGLT  1680
ELPGMLGDAE AEEEEEQEAA AAAGDEVTDP GTGSGSGQAG RRRGGGGGGS GSAQAADATP  1740
PPEGEGTEIV GSVGSGRAAT GLRSGGGAVG DASFIRPGGG GGMSFLASAV GGGGGGGGGQ  1800
QMTTTVDFSG LDGGGGGSWW LSKGSGEGEG EERSVVSSGA MAAVAAGARR EGLSGGGGVG  1860
GGVVMDAEDV DMDDTTSLAA EAAAAAAADL AAAAAGPAVG AVGVRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-17331051183squamosa promoter binding protein-like 4
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre16.g686100.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3CUQ40.0A0A2K3CUQ4_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.14e-22squamosa promoter binding protein-like 8