PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_63.29 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 175aa MW: 20036.4 Da PI: 5.0559 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 107.7 | 1.4e-33 | 8 | 116 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 lppGfrF Ptdeelvv++L+ +vi+++d+y ++Pw+L+ k+ ae ++wyf+s+r +nr t++g evm.model.supercontig_63.29 8 LPPGFRFYPTDEELVVHFLH-----------HVIPDLDLYPYDPWELDGKALAEGNRWYFYSRRT--------QNRNTSNGH 70 79****************96...........46999***********977778899******984........58999**** PP NAM 83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 Wk+ g d++v++++g+ vg+kk +vfy g+ap g kt+W+mheyrl evm.model.supercontig_63.29 71 WKSMGIDEPVITSSGKRVGMKKYFVFYVGEAPAGIKTNWIMHEYRL 116 ********************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.62E-46 | 5 | 146 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 35.603 | 8 | 148 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.1E-23 | 9 | 116 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MGDGNVNLPP GFRFYPTDEE LVVHFLHHVI PDLDLYPYDP WELDGKALAE GNRWYFYSRR 60 TQNRNTSNGH WKSMGIDEPV ITSSGKRVGM KKYFVFYVGE APAGIKTNWI MHEYRLPDSA 120 SSSRSTKRSA RAKTLDYSKW VVCRVYEDDD GTELSCLDEV FLSLDDLDEI SLPN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 8e-42 | 5 | 153 | 17 | 173 | NAC domain-containing protein 19 |
3swm_B | 8e-42 | 5 | 153 | 17 | 173 | NAC domain-containing protein 19 |
3swm_C | 8e-42 | 5 | 153 | 17 | 173 | NAC domain-containing protein 19 |
3swm_D | 8e-42 | 5 | 153 | 17 | 173 | NAC domain-containing protein 19 |
3swp_A | 8e-42 | 5 | 153 | 17 | 173 | NAC domain-containing protein 19 |
3swp_B | 8e-42 | 5 | 153 | 17 | 173 | NAC domain-containing protein 19 |
3swp_C | 8e-42 | 5 | 153 | 17 | 173 | NAC domain-containing protein 19 |
3swp_D | 8e-42 | 5 | 153 | 17 | 173 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_63.29 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021896566.1 | 1e-124 | NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 3e-73 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A061E1M1 | 7e-93 | A0A061E1M1_THECC; NAC domain protein, IPR003441 isoform 1 | ||||
STRING | evm.model.supercontig_63.29 | 1e-128 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3674 | 28 | 62 | Representative plant | OGRP4510 | 10 | 24 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 3e-73 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_63.29 |
Publications ? help Back to Top | |||
---|---|---|---|
|