PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm.model.supercontig_178.22

Organism

Carica papaya

Taxonomic ID

3649

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica

Family

MYB_related

Protein Properties

Length: 157aa MW: 17708 Da PI: 10.6901

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm.model.supercontig_178.22	genome	ASGPB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.6	2.5e-17	57	101	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r rWT eE++++++a k++G W++I +++g ++t+ q++s+ qk+ evm.model.supercontig_178.22 57 RERWTDEEHKKFIEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 101 78****************88.*****.**********98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	3.29E-17	51	105	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.341	52	106	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	3.7E-10	54	106	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.6E-17	55	104	IPR006447	Myb domain, plants
SMART	SM00717	3.1E-13	56	104	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-14	57	100	IPR001005	SANT/Myb domain
CDD	cd00167	3.21E-11	59	102	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 157 aa Download sequence Send to blast
MAVQDQRIGS RSNTVLTAGN GDIVTAGLYN VTRQEQFPCG HDYAPKVRKP YTITKQRERW 60 TDEEHKKFIE ALKLYGRAWR RIEEHVGTKT AVQIRSHAQK FFSKVVRETS GSNTSSVEPI 120 EIPPPRPKRK PMHPYPLSSA AGVRINQRGE TNNQPA*

Functional Description ? help Back to Top
Source	Description
UniProt	Morning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269\|PubMed:19805390, ECO:0000269\|PubMed:23240770}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	evm.model.supercontig_178.22

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269\|PubMed:19805390, ECO:0000269\|PubMed:23240770}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021888061.1	7e-99	protein REVEILLE 1-like
Swissprot	F4KGY6	8e-49	RVE1_ARATH; Protein REVEILLE 1
TrEMBL	A0A067KI22	1e-59	A0A067KI22_JATCU; Uncharacterized protein
STRING	evm.model.supercontig_178.22	1e-113	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6356	26	44
Representative plant	OGRP1255	15	49

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G17300.1	3e-48	MYB_related family protein

Link Out ? help Back to Top
Phytozome	evm.model.supercontig_178.22

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xu G, et al. REVEILLE1 promotes NADPH: protochlorophyllide oxidoreductase A expression and seedling greening in Arabidopsis. Photosyn. Res., 2015. 126(2-3): p. 331-40 [PMID:25910753] Jiang Z,Xu G,Jing Y,Tang W,Lin R Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis. Nat Commun, 2016. 7: p. 12377 [PMID:27506149]