PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID IGS.gm_12_00016
Common NameCHLNCDRAFT_134630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family NF-YC
Protein Properties Length: 254aa    MW: 25712.5 Da    PI: 5.0458
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
IGS.gm_12_00016genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC40.27.5e-1313872397
            NF-YC 23 larikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivp 97
                      arikk++++dedv ++s  +Pvl++ka ++f+  +   +   ae+   r l  s i+a ++  +  dfl d v 
  IGS.gm_12_00016 13 QARIKKMMQSDEDVGKVSKASPVLIAKALDIFLQSMVDGAARIAESRGARMLTASHIKAHIQGEELLDFLKDAVA 87
                     48**********************************9999999*****************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008082.0E-131471IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471132.97E-161488IPR009072Histone-fold
Gene3DG3DSA:1.10.20.103.5E-201486IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MASKGMKAST NLQARIKKMM QSDEDVGKVS KASPVLIAKA LDIFLQSMVD GAARIAESRG  60
ARMLTASHIK AHIQGEELLD FLKDAVAAVA ELPPAGAEPV KGAKQKRQRA KNSGNEGEAG  120
PSKVRSRGGR GGRGGKGRKG TSDEDAAAVC ERAAPAGNDS AGCVRDEDHA AGDLADADTA  180
QQQQQQHQPE AQQEASAGQG GPTIAPAVPQ QEEGGTGGVE PGAGGGMPLV SVPSFLAAAA  240
VPGAEAEEED YDA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A1e-1614761577Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103108KQKRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005847021.11e-179hypothetical protein CHLNCDRAFT_134630
TrEMBLE1ZGE11e-178E1ZGE1_CHLVA; Uncharacterized protein
STRINGXP_005847021.11e-178(Chlorella variabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP33431313
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G19490.15e-21NF-YC family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]