PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | snap_masked-scaffold10177-abinit-gene-0.1-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 137aa MW: 15138.3 Da PI: 7.8621 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 90.3 | 5.1e-28 | 10 | 84 | 2 | 73 |
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshld 64 d+ seq+Cyv+Cn C+t+lavsvP tslfk+vtvrCGhCt+ll vn++ a + hl+ snap_masked-scaffold10177-abinit-gene-0.1-mRNA-1 10 DHLPPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSANQFHLG 72 57789*****************************************99999999999999999 PP YABBY 65 eslkee...lle 73 +s+ + lle snap_masked-scaffold10177-abinit-gene-0.1-mRNA-1 73 HSFFSPshnLLE 84 998776333333 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 2.5E-27 | 14 | 70 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MSSSSTLSLD HLPPSEQLCY VHCNICDTVL AVSVPCTSLF KTVTVRCGHC TNLLPVNMRG 60 LLLPSANQFH LGHSFFSPSH NLLEEIPNPS PNFLINQNNG SDFTMPARGG VGELPRPPAI 120 NRRKNHYIFS IFKSFET |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000250}. | |||||
UniProt | May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000269|PubMed:17351053}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by WOX3. {ECO:0000269|PubMed:17351053}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB609993 | 0.0 | AB609993.1 Castanea crenata mRNA, microsatellite: PEA40, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023908666.1 | 4e-83 | protein YABBY 4-like | ||||
Swissprot | Q01JG2 | 1e-31 | YAB5_ORYSI; Protein YABBY 5 | ||||
Swissprot | Q0JBF0 | 1e-31 | YAB5_ORYSJ; Protein YABBY 5 | ||||
TrEMBL | A0A2I4GW09 | 2e-78 | A0A2I4GW09_JUGRE; protein YABBY 4-like isoform X1 | ||||
STRING | VIT_02s0154g00070.t01 | 4e-75 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2040 | 34 | 90 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45190.1 | 1e-28 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|