PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | snap_masked-scaffold08322-abinit-gene-0.9-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 76aa MW: 8564.71 Da PI: 4.2214 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 53.8 | 6.4e-17 | 29 | 75 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 + pGfrF+Ptdeel+++yLkkk+eg + + evi+ev+++++ePwdLp snap_masked-scaffold08322-abinit-gene-0.9-mRNA-1 29 MFPGFRFSPTDEELISYYLKKKLEGYEQCV-EVISEVEMCRHEPWDLP 75 579************************777.99**************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.55E-17 | 20 | 76 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 19.326 | 29 | 76 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.1E-7 | 31 | 72 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MEGTSSSREA LMIGGVSREV EVSIAASTMF PGFRFSPTDE ELISYYLKKK LEGYEQCVEV 60 ISEVEMCRHE PWDLPG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023881532.1 | 5e-42 | NAC domain-containing protein 60 | ||||
Swissprot | Q9XIN7 | 2e-21 | NAC40_ARATH; NAC domain-containing protein 40 | ||||
TrEMBL | A0A061GVB5 | 2e-29 | A0A061GVB5_THECC; NAC domain-containing protein 74, putative isoform 2 | ||||
TrEMBL | A0A061GVZ7 | 3e-29 | A0A061GVZ7_THECC; NAC domain protein, IPR003441, putative isoform 1 | ||||
TrEMBL | A0A061GZN7 | 5e-29 | A0A061GZN7_THECC; NAC domain-containing protein 74, putative isoform 3 (Fragment) | ||||
TrEMBL | A0A2N9IRR2 | 4e-32 | A0A2N9IRR2_FAGSY; Uncharacterized protein | ||||
STRING | EOY33354 | 9e-30 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF11433 | 17 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G27300.1 | 9e-24 | NTM1-like 8 |
Publications ? help Back to Top | |||
---|---|---|---|
|