PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G27300.1 | ||||||||
Common Name | ANAC040, F12K2.12, NTL8 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 335aa MW: 38183.9 Da PI: 6.2761 | ||||||||
Description | NTM1-like 8 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 157.1 | 7.3e-49 | 14 | 140 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 l pGfrF+Ptd el+++yL++k++g+++++ vi+ev+iyk+ePwdLp ++ ++e+ew++F+ r +ky++g++++rat+ gyWkatgk+++v+s ++ AT2G27300.1 14 LFPGFRFSPTDVELISYYLRRKIDGDENSV-AVIAEVEIYKFEPWDLPeESKLKSENEWFYFCARGRKYPHGSQSRRATQLGYWKATGKERSVKS-GN 109 579************************999.89***************433334678**************************************.99 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 ++vg+k+tLvf+ grap+ge+t+W+mhey + AT2G27300.1 110 QVVGTKRTLVFHIGRAPRGERTEWIMHEYCI 140 9****************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.15E-55 | 6 | 155 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 52.473 | 14 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.6E-24 | 16 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009845 | Biological Process | seed germination | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0009938 | Biological Process | negative regulation of gibberellic acid mediated signaling pathway | ||||
GO:0033619 | Biological Process | membrane protein proteolysis | ||||
GO:0048573 | Biological Process | photoperiodism, flowering | ||||
GO:0071472 | Biological Process | cellular response to salt stress | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005886 | Cellular Component | plasma membrane | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000001 | anatomy | plant embryo proper | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0009015 | anatomy | portion of vascular tissue | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009049 | anatomy | inflorescence |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 335 aa Download sequence Send to blast |
MSKEAEMSIA VSALFPGFRF SPTDVELISY YLRRKIDGDE NSVAVIAEVE IYKFEPWDLP 60 EESKLKSENE WFYFCARGRK YPHGSQSRRA TQLGYWKATG KERSVKSGNQ VVGTKRTLVF 120 HIGRAPRGER TEWIMHEYCI HGAPQDALVV CRLRKNADFR ASSTQKMEDG VVQDDGYVGQ 180 RGGLEKEDKS YYESEHQIPN GDIAESSNVV EDQADTDDDC YAEILNDDII KLDEEALKAS 240 QAFRPTNPTH QETISSESSS KRSKCGIKKE STETMNCYAL FRIKNVAGTD SSWRFPNPFK 300 IKKDDSQRLM KNVLATTVFL AILFSFFWTV LIARN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 8e-43 | 4 | 138 | 10 | 138 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 18401385 | 0.0 | ||||
Genevisible | 265621_at | 0.0 | ||||
Expression Atlas | AT2G27300 | - | ||||
AtGenExpress | AT2G27300 | - | ||||
ATTED-II | AT2G27300 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Accumulates in imbibed seeds (PubMed:19704545). Detected in early stages of seed development, especially in the basal tip of immature embryo. Particularly expressed in vascular tissues of inflorescence stems, roots, leaves and petioles (PubMed:17410378). {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:19704545}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seeds, leaves, roots and inflorescence (PubMed:17410378). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00280 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G27300.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator (A: Activate/R: Repress) | |||||
ATRM | AT3G03450 (A) |
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Target Gene (A: Activate/R: Repress) | |||||
ATRM | AT1G65480(R) |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: In ntl8-1, no discernible phenotypic changes except slight differences in lateral root growth and flowering time, as well as reduced lateral root growth rate. Insensitive to high salt. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704545}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G27300 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT028934 | 0.0 | BT028934.1 Arabidopsis thaliana At2g27300 mRNA, complete cds. | |||
GenBank | DQ056544 | 0.0 | DQ056544.1 Arabidopsis thaliana no apical meristem family protein (At2g27300) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_180298.1 | 0.0 | NTM1-like 8 | ||||
Swissprot | Q9XIN7 | 0.0 | NAC40_ARATH; NAC domain-containing protein 40 | ||||
TrEMBL | A0A178W0Y4 | 0.0 | A0A178W0Y4_ARATH; NTL8 | ||||
STRING | AT2G27300.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10453 | 25 | 33 | Representative plant | OGRP10249 | 6 | 10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G27300.1 |
Entrez Gene | 817273 |
iHOP | AT2G27300 |
wikigenes | AT2G27300 |