PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | snap_masked-scaffold03271-abinit-gene-0.12-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 135aa MW: 14844 Da PI: 6.6095 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 101.5 | 1.7e-31 | 11 | 125 | 2 | 116 |
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes 61 d+ s seq+Cyv+CnfC+t+lavsvP tslfk+vtvrCGhCt+llsvn++ a + snap_masked-scaffold03271-abinit-gene-0.12-mRNA-1 11 DHLSPSEQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLFIPSANQL 70 78899*******************************************999999999999 PP YABBY 62 hldeslkee...lleelkveeenlksnvekeesastsvsseklsenedeevprvppvi 116 hl++++ + lle+ + + n+ n+ + + +s + + ee+p++p v snap_masked-scaffold03271-abinit-gene-0.12-mRNA-1 71 HLGHAFFSTpqnLLEDIRGSPPNMMINQPNPNDES---MMPVRVGADLEEIPKPPVVT 125 99999876634466666666666555554443332...22222455667777766555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 5.9E-29 | 15 | 73 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MSASSTAFSP DHLSPSEQLC YVHCNFCDTV LAVSVPCTSL FKTVTVRCGH CTNLLSVNMR 60 GLFIPSANQL HLGHAFFSTP QNLLEDIRGS PPNMMINQPN PNDESMMPVR VGADLEEIPK 120 PPVVTRHVSH WSLQV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000250}. | |||||
UniProt | May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000269|PubMed:17351053}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by WOX3. {ECO:0000269|PubMed:17351053}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023898877.1 | 2e-79 | axial regulator YABBY 1-like isoform X1 | ||||
Swissprot | Q01JG2 | 2e-33 | YAB5_ORYSI; Protein YABBY 5 | ||||
Swissprot | Q0JBF0 | 2e-33 | YAB5_ORYSJ; Protein YABBY 5 | ||||
TrEMBL | A0A061DU75 | 2e-67 | A0A061DU75_THECC; Plant-specific transcription factor YABBY family protein isoform 1 | ||||
STRING | EOX96270 | 4e-68 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2040 | 34 | 90 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45190.1 | 5e-34 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|