PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

snap_masked-scaffold01784-abinit-gene-0.13-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

EIL

Protein Properties

Length: 110aa MW: 12566 Da PI: 10.6095

Description

EIL family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
snap_masked-scaffold01784-abinit-gene-0.13-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	EIN3	135.6	7.6e-42	1	108	7	119
XXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS EIN3 7 mwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemev 66 mwkd ++l+rl er+k +++a ++++k ++++e r sraQ giLkYMlk mev snap_masked-scaffold01784-abinit-gene-0.13-mRNA-1 1 MWKDHIKLNRLMERQKIA--AQQA-AEKRKPKQTTE--IRLGGSRAQVGILKYMLKLMEV 55 9******999999863..4554.67777666666..47889************* PP XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS EIN3 67 cnaqGfvYgiipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlil 119 c++ GfvYgiipekgkp +gas+++r+WWkekv+fd+ngpaai+ky+ak+l++ snap_masked-scaffold01784-abinit-gene-0.13-mRNA-1 56 CKVCGFVYGIIPEKGKPLSGASNNIRSWWKEKVKFDKNGPAAITKYEAKCLAM 108 ***********************************************9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04873	1.2E-42	1	107	No hit	No description

Sequence ? help Back to Top
Protein Sequence Length: 110 aa Download sequence Send to blast
MWKDHIKLNR LMERQKIAAQ QAAEKRKPKQ TTEIRLGGSR AQVGILKYML KLMEVCKVCG 60 FVYGIIPEKG KPLSGASNNI RSWWKEKVKF DKNGPAAITK YEAKCLAMIE

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in the ethylene response pathway. {ECO:0000269\|PubMed:9215635, ECO:0000269\|PubMed:9851977}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ298994	1e-120	AJ298994.1 Fagus sylvatica mRNA for EIN3/EIL-like transcription regulator (einl1 gene), clone FsEINL1.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023890819.1	8e-55	ETHYLENE INSENSITIVE 3-like 3 protein
Swissprot	O23116	6e-46	EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBL	Q9FDV5	1e-53	Q9FDV5_FAGSY; Ethylene insensitive (EIN3/EIL)-like transcription regulator
STRING	EOY32534	3e-53	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF322	34	200

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G73730.1	2e-48	ETHYLENE-INSENSITIVE3-like 3

Publications ? help Back to Top
Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Zheng ZL,Zhang B,Leustek T Transceptors at the boundary of nutrient transporters and receptors: a new role for Arabidopsis SULTR1;2 in sulfur sensing. Front Plant Sci, 2014. 5: p. 710 [PMID:25566284] Panda SK,Sunkar R Nutrient- and other stress-responsive microRNAs in plants: Role for thiol-based redox signaling. Plant Signal Behav, 2015. 10(4): p. e1010916 [PMID:25912823] Wawrzyńska A,Sirko A EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor. Plant Sci., 2016. 253: p. 50-57 [PMID:27968996]