PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | maker-scaffold08760-augustus-gene-0.9-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 83aa MW: 9596.77 Da PI: 6.6774 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 82.8 | 4.9e-26 | 19 | 78 | 2 | 61 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 Fl+k+y++++d+++++++sw++ g+sfvv+d+++f++++Lpk Fkh+nf+SFvRQLn+++ maker-scaffold08760-augustus-gene-0.9-mRNA-1 19 FLTKTYDMVDDPTTNHIVSWNRGGTSFVVWDPHSFSTNLLPKQFKHNNFSSFVRQLNTFD 78 9********************************************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 5.0E-28 | 13 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 3.8E-21 | 15 | 83 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 5.17E-23 | 17 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 2.4E-15 | 19 | 42 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 4.1E-22 | 19 | 78 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.4E-15 | 57 | 69 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.4E-15 | 70 | 82 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
MMPPPQLMEG LHDTGSPPFL TKTYDMVDDP TTNHIVSWNR GGTSFVVWDP HSFSTNLLPK 60 QFKHNNFSSF VRQLNTFDTE HFK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1hks_A | 4e-17 | 14 | 77 | 2 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
1hkt_A | 4e-17 | 14 | 77 | 2 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011026101.1 | 1e-43 | PREDICTED: heat stress transcription factor A-6b-like isoform X1 | ||||
Swissprot | Q9M1V5 | 4e-38 | HFA7B_ARATH; Heat stress transcription factor A-7b | ||||
TrEMBL | B9GSI7 | 2e-41 | B9GSI7_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0002s04900.1 | 6e-42 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1592 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G63350.1 | 2e-40 | HSF family protein |