PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | maker-scaffold05705-snap-gene-0.17-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 112aa MW: 13127.5 Da PI: 9.7294 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 43.5 | 7.1e-14 | 50 | 107 | 17 | 74 |
NF-YC 17 knhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtl 74 ++++P arikki++aded+ +i+ +P l+ska elf+ +l +++ + + +t+ maker-scaffold05705-snap-gene-0.17-mRNA-1 50 LDTRFPAARIKKIMQADEDIGKIAMAVPLLVSKALELFLQDLCAQTYEITLKRGAKTM 107 3689**************************************9999887777666665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.5E-23 | 47 | 112 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.57E-13 | 53 | 112 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.9E-17 | 53 | 112 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
FCCYCFYLRL YKQNQKIQRD TDTERYREIL GIFFSLSLRV PSLDNMRKKL DTRFPAARIK 60 KIMQADEDIG KIAMAVPLLV SKALELFLQD LCAQTYEITL KRGAKTMNSL HL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_A | 1e-21 | 43 | 112 | 1 | 70 | Transcription Regulator NC2 alpha chain |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023896354.1 | 3e-39 | dr1-associated corepressor-like | ||||
Swissprot | A0JPP1 | 5e-20 | NC2A_RAT; Dr1-associated corepressor | ||||
Swissprot | Q14919 | 5e-20 | NC2A_HUMAN; Dr1-associated corepressor | ||||
Swissprot | Q2YDP3 | 5e-20 | NC2A_BOVIN; Dr1-associated corepressor | ||||
Swissprot | Q9D6N5 | 6e-20 | NC2A_MOUSE; Dr1-associated corepressor | ||||
TrEMBL | A0A0B2PUJ1 | 2e-36 | A0A0B2PUJ1_GLYSO; Dr1-associated corepressor | ||||
TrEMBL | A0A2I4FPZ8 | 2e-36 | A0A2I4FPZ8_JUGRE; dr1-associated corepressor-like isoform X4 | ||||
STRING | GLYMA14G04321.1 | 2e-36 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1728 | 34 | 91 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12480.1 | 1e-37 | nuclear factor Y, subunit C11 |