PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | maker-scaffold04312-snap-gene-0.21-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 148aa MW: 17365.6 Da PI: 9.81 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 144.4 | 6.1e-45 | 9 | 136 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkk 67 pG+rF+Ptd+el+++yLk k++g++++ + i+e+diyk+ePwdLp +++ +++k w+f + ++ k maker-scaffold04312-snap-gene-0.21-mRNA-1 9 LPGYRFSPTDDELIDDYLKLKITGNENKNTWRIPEIDIYKYEPWDLPnfARIPTKDKVWHFITAQSLK 76 59************************999777***************544888899************ PP NAM 68 yatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++g+ nr+t++g+Wk+tgkd++++s +ge++g+kk+Lv++ gr+p+ge+t+W mheyr maker-scaffold04312-snap-gene-0.21-mRNA-1 77 HKNGSSMNRSTQKGFWKSTGKDRKIKS-GGEVIGMKKSLVYHIGRSPNGERTEWKMHEYRT 136 ***************************.*******************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 44.263 | 8 | 148 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 3.01E-46 | 8 | 141 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.6E-23 | 10 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MDDPDLYSLP GYRFSPTDDE LIDDYLKLKI TGNENKNTWR IPEIDIYKYE PWDLPNFARI 60 PTKDKVWHFI TAQSLKHKNG SSMNRSTQKG FWKSTGKDRK IKSGGEVIGM KKSLVYHIGR 120 SPNGERTEWK MHEYRTTQKE FDGKHPGQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-34 | 10 | 135 | 17 | 139 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250|UniProtKB:Q9SCK6, ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774, ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by bacterial pathogens type III effector proteins (TTEs). {ECO:0000269|PubMed:16553893}.; INDUCTION: (Microbial infection) Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269|PubMed:24418554}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023913056.1 | 6e-95 | NAC domain containing protein 50-like isoform X1 | ||||
Refseq | XP_023913057.1 | 6e-95 | NAC domain containing protein 50-like isoform X2 | ||||
Swissprot | Q9LKG8 | 5e-48 | NAC91_ARATH; NAC domain-containing protein 91 | ||||
TrEMBL | A0A2I4F938 | 2e-53 | A0A2I4F938_JUGRE; LOW QUALITY PROTEIN: NAC domain-containing protein 91-like | ||||
STRING | EOY23734 | 1e-50 | (Theobroma cacao) | ||||
STRING | XP_004514021.1 | 1e-50 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2065 | 25 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G24590.2 | 2e-50 | TCV-interacting protein |
Publications ? help Back to Top | |||
---|---|---|---|
|