PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C025597P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 200aa MW: 22745.1 Da PI: 11.6575 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 133.3 | 7.9e-42 | 74 | 150 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cq+++C+adlseak+yhrrhkvCe+hska+ v+v+g++qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++a MELO3C025597P1 74 CQAHNCAADLSEAKRYHRRHKVCEFHSKAAIVMVAGIRQRFCQQCSRFHELTEFDEAKRSCRRRLAGHNERRRKNSA 150 **************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 8.0E-34 | 67 | 135 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.257 | 71 | 148 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.83E-38 | 72 | 151 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.4E-31 | 74 | 147 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MQRALKASII PKIRQWSMTI SNTRRRRRRL VEEEEVAIAM LAMHWVILTM RKGKRGAAVS 60 GRGKSGGSVS SPSCQAHNCA ADLSEAKRYH RRHKVCEFHS KAAIVMVAGI RQRFCQQCSR 120 FHELTEFDEA KRSCRRRLAG HNERRRKNSA ESQGESTSRK SAPQAQSKES HCRQLVEDQR 180 SRIQMAPPGS SGYKHLHIR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-36 | 65 | 147 | 2 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 23 | 28 | RRRRRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681862 | 0.0 | LN681862.1 Cucumis melo genomic scaffold, anchoredscaffold00081. | |||
GenBank | LN713261 | 0.0 | LN713261.1 Cucumis melo genomic chromosome, chr_7. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016903072.1 | 1e-102 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
Swissprot | Q9S758 | 3e-41 | SPL5_ARATH; Squamosa promoter-binding-like protein 5 | ||||
TrEMBL | A0A1S4E4C7 | 1e-100 | A0A1S4E4C7_CUCME; squamosa promoter-binding protein 1-like | ||||
STRING | XP_008463797.1 | 1e-101 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 5e-42 | squamosa promoter binding protein-like 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|