PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C019803P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 114aa MW: 12553.7 Da PI: 9.8088 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 59.1 | 5.9e-19 | 4 | 37 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 C +C +tkTp+WR gp g+ktLCnaCG++y++ + MELO3C019803P1 4 CLHCEVTKTPQWRAGPLGPKTLCNACGVRYKSGR 37 99*****************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 11.675 | 1 | 34 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 7.5E-15 | 2 | 36 | IPR013088 | Zinc finger, NHR/GATA-type |
SuperFamily | SSF57716 | 4.75E-15 | 2 | 61 | No hit | No description |
SMART | SM00401 | 3.5E-12 | 2 | 48 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 5.56E-14 | 3 | 60 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 4 | 29 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 1.1E-16 | 4 | 37 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MRKCLHCEVT KTPQWRAGPL GPKTLCNACG VRYKSGRLYP EYRPAASPTF VPCLHSNSHK 60 KVLEMRIKQV KKGVELTGEE SPPELIPNTD SGIILGYIRP EKAILTVPSQ TIP* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681821 | 0.0 | LN681821.1 Cucumis melo genomic scaffold, anchoredscaffold00040. | |||
GenBank | LN713257 | 0.0 | LN713257.1 Cucumis melo genomic chromosome, chr_3. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004149904.1 | 4e-69 | PREDICTED: GATA transcription factor 8-like | ||||
Swissprot | Q9SV30 | 5e-43 | GATA8_ARATH; GATA transcription factor 8 | ||||
TrEMBL | A0A0A0KDP1 | 9e-68 | A0A0A0KDP1_CUCSA; GATA transcription factor | ||||
STRING | XP_008456488.1 | 5e-78 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4887 | 33 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54810.2 | 2e-45 | GATA family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|