PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C018055P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 219aa MW: 25417.9 Da PI: 10.0571 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 79.8 | 1.9e-25 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n rqvtfskRr g++KKA+EL +LCda++a+i+fs +gkl++yss MELO3C018055P1 9 KKIDNIAARQVTFSKRRRGLFKKAHELATLCDADIALIVFSASGKLFDYSS 59 689**********************************************96 PP | |||||||
2 | K-box | 47.5 | 7.7e-17 | 87 | 158 | 17 | 88 |
K-box 17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 + +akL +e +e+Rh++Ge+L++L ++eL++Le+ Le++l+++ ++K+e +l++i + ++k ++ MELO3C018055P1 87 EKSAHAKLTEEFAAKTKELRHMKGEELQELGIEELKELEKLLENGLNRVIETKDEKFLKEIGTVKEKVIKHF 158 5677899******99***************************************************988765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.819 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 9.42E-29 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-25 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.14E-35 | 3 | 69 | No hit | No description |
Pfam | PF00319 | 2.9E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-25 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-25 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.856 | 84 | 187 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.9E-12 | 88 | 154 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MTRQKIEIKK IDNIAARQVT FSKRRRGLFK KAHELATLCD ADIALIVFSA SGKLFDYSSS 60 SMLDLLRRHN MLPELNNISQ LPPSQLEKSA HAKLTEEFAA KTKELRHMKG EELQELGIEE 120 LKELEKLLEN GLNRVIETKD EKFLKEIGTV KEKVIKHFLI NFCIFSLKFL HSLTNYFRFL 180 VCRSEVLFSI VINFVSHFGF FLKKKINRVS LFIIYCFN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 7e-17 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
6bz1_B | 7e-17 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
6bz1_C | 7e-17 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
6bz1_D | 7e-17 | 1 | 74 | 1 | 74 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681874 | 1e-132 | LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031. | |||
GenBank | LN713261 | 1e-132 | LN713261.1 Cucumis melo genomic chromosome, chr_7. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008454463.1 | 1e-106 | PREDICTED: MADS-box protein JOINTLESS-like isoform X1 | ||||
Swissprot | Q9FVC1 | 2e-53 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A1S3BYS5 | 1e-104 | A0A1S3BYS5_CUCME; MADS-box protein JOINTLESS-like isoform X1 | ||||
STRING | XP_008454463.1 | 1e-105 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF890 | 33 | 106 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 3e-40 | MIKC_MADS family protein |