PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C016400P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 153aa MW: 17406.6 Da PI: 5.3129 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 41.5 | 2.9e-13 | 25 | 83 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+++NRe+ArrsR RK+++++ L+ v ++ +eN++ + +++ ++++ +l++e+ MELO3C016400P1 25 RKRKRMISNRESARRSRMRKQKQLDDLTSQVGQIRTENEQIAVNINFTTQLYVNLEAEN 83 6789******************************************9999999999887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 8.6E-14 | 21 | 85 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.14 | 23 | 86 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 9.2E-10 | 25 | 97 | No hit | No description |
Pfam | PF00170 | 1.2E-10 | 25 | 68 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 7.72E-12 | 25 | 79 | No hit | No description |
CDD | cd14702 | 4.56E-17 | 26 | 76 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 28 | 43 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MASPVGSSSG SPSSDEDLRL IVDQRKRKRM ISNRESARRS RMRKQKQLDD LTSQVGQIRT 60 ENEQIAVNIN FTTQLYVNLE AENSVLRAQM VELRHRLDSL NEIIRFMNSS TRRLYDNSEE 120 NDEACGIDGF VDSWGFPFLN QPIMAAGDLF MC* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 24 | 45 | RKRKRMISNRESARRSRMRKQK |
2 | 37 | 44 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681873 | 0.0 | LN681873.1 Cucumis melo genomic scaffold, anchoredscaffold00027. | |||
GenBank | LN713261 | 0.0 | LN713261.1 Cucumis melo genomic chromosome, chr_7. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008452107.1 | 1e-109 | PREDICTED: bZIP transcription factor 53 | ||||
Swissprot | C0Z2L5 | 3e-43 | BZP44_ARATH; bZIP transcription factor 44 | ||||
TrEMBL | A0A1S3BT51 | 1e-108 | A0A1S3BT51_CUCME; bZIP transcription factor 53 | ||||
STRING | XP_008452107.1 | 1e-109 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF613 | 34 | 147 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G75390.1 | 2e-44 | basic leucine-zipper 44 |
Publications ? help Back to Top | |||
---|---|---|---|
|