PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C016337P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 147aa MW: 16666.8 Da PI: 10.2795 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 102.9 | 1.8e-32 | 67 | 125 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk s++prsYYrCt+++C+vkk+++r ++dp++v++tYeg Hnh+ MELO3C016337P1 67 LDDGYRWRKYGQKAVKHSNHPRSYYRCTHHTCNVKKQIQRHSKDPTIVVTTYEGIHNHP 125 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.7E-33 | 54 | 126 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.53E-28 | 61 | 126 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.782 | 62 | 127 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.8E-37 | 67 | 126 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.2E-25 | 68 | 125 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MGDSNYDNNN NVVIGGVKEG DIVISGGNNH NNNNNIKYKG RMVMGKRRSA MASPRIAFQT 60 RSVEDVLDDG YRWRKYGQKA VKHSNHPRSY YRCTHHTCNV KKQIQRHSKD PTIVVTTYEG 120 IHNHPSEKLM ETLTPLLKQL QFLSGI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-25 | 57 | 124 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 4e-25 | 57 | 124 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00539 | DAP | Transfer from AT5G41570 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681873 | 1e-145 | LN681873.1 Cucumis melo genomic scaffold, anchoredscaffold00027. | |||
GenBank | LN713261 | 1e-145 | LN713261.1 Cucumis melo genomic chromosome, chr_7. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008452004.1 | 1e-106 | PREDICTED: probable WRKY transcription factor 43 | ||||
Swissprot | Q9FFS3 | 2e-55 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | A0A1S3BSW1 | 1e-105 | A0A1S3BSW1_CUCME; probable WRKY transcription factor 43 | ||||
STRING | XP_008452004.1 | 1e-105 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3227 | 34 | 71 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 6e-57 | WRKY DNA-binding protein 24 |