PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C015925P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 130aa MW: 15108.4 Da PI: 6.7966 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 41.5 | 3e-13 | 6 | 56 | 4 | 54 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 k+ +r+q+NRe+ArrsR RK+++ e L+ +v eL+ N++ + ++ ++ MELO3C015925P1 6 KKKMKRMQSNRESARRSRMRKQKRFEDLTSEVRELQIVNSRIVESVNGREE 56 6999********************************999988877766555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.2E-8 | 3 | 70 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 7.8E-9 | 4 | 60 | No hit | No description |
PROSITE profile | PS50217 | 9.519 | 5 | 68 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.4E-11 | 6 | 57 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 8.75E-11 | 7 | 61 | No hit | No description |
CDD | cd14702 | 9.31E-14 | 8 | 52 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 10 | 25 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MIDDTKKKMK RMQSNRESAR RSRMRKQKRF EDLTSEVREL QIVNSRIVES VNGREEAMVE 60 IESMNNFLRV EAIEMTCRLR ALDLVLQIQD DANAVAFDVR DPLLEPWQLN QQKQPPPPLM 120 AADYGTFLV* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 19 | 26 | RRSRMRKQ |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681803 | 0.0 | LN681803.1 Cucumis melo genomic scaffold, anchoredscaffold00026. | |||
GenBank | LN713255 | 0.0 | LN713255.1 Cucumis melo genomic chromosome, chr_1. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008451653.1 | 5e-90 | PREDICTED: bZIP transcription factor 53-like | ||||
TrEMBL | A0A1S3BS27 | 1e-88 | A0A1S3BS27_CUCME; bZIP transcription factor 53-like | ||||
STRING | XP_008451653.1 | 2e-89 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF24718 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G62420.1 | 2e-22 | basic region/leucine zipper motif 53 |