PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C014509P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 173aa MW: 19707.6 Da PI: 8.3092 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 158.9 | 2.1e-49 | 17 | 143 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 + pGfrF+P+deel+ +yLkkk+eg++ ++ +vi+e++i+k+ePwdLp k + +e+ew+fFs+r +ky++g++++rat+ gyWkatgk+++v++ MELO3C014509P1 17 MFPGFRFSPKDEELILFYLKKKLEGSDDSV-DVISEIEICKFEPWDLPGKSRIpSENEWFFFSPRGRKYPNGTQNKRATELGYWKATGKERNVKT 110 579************************999.99***************544433788*************************************9 PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++e +g+k+tLvf+ grap+ge+t+W+mhey l MELO3C014509P1 111 -GSEIIGTKRTLVFHLGRAPTGERTEWIMHEYCL 143 .9******************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.02E-53 | 9 | 151 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 49.682 | 17 | 172 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.1E-26 | 19 | 143 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MGGVSREAEM SMAALSMFPG FRFSPKDEEL ILFYLKKKLE GSDDSVDVIS EIEICKFEPW 60 DLPGKSRIPS ENEWFFFSPR GRKYPNGTQN KRATELGYWK ATGKERNVKT GSEIIGTKRT 120 LVFHLGRAPT GERTEWIMHE YCLNDKSQVN FKIFLSGFFS MNCYAICIIA GF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 2e-45 | 12 | 169 | 15 | 165 | NAC domain-containing protein 19 |
3swm_B | 2e-45 | 12 | 169 | 15 | 165 | NAC domain-containing protein 19 |
3swm_C | 2e-45 | 12 | 169 | 15 | 165 | NAC domain-containing protein 19 |
3swm_D | 2e-45 | 12 | 169 | 15 | 165 | NAC domain-containing protein 19 |
3swp_A | 2e-45 | 12 | 169 | 15 | 165 | NAC domain-containing protein 19 |
3swp_B | 2e-45 | 12 | 169 | 15 | 165 | NAC domain-containing protein 19 |
3swp_C | 2e-45 | 12 | 169 | 15 | 165 | NAC domain-containing protein 19 |
3swp_D | 2e-45 | 12 | 169 | 15 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681842 | 0.0 | LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022. | |||
GenBank | LN713259 | 0.0 | LN713259.1 Cucumis melo genomic chromosome, chr_5. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016900731.1 | 1e-106 | PREDICTED: NAC domain-containing protein 40 | ||||
Swissprot | Q9XIN7 | 6e-73 | NAC40_ARATH; NAC domain-containing protein 40 | ||||
TrEMBL | A0A1S4DXM3 | 1e-105 | A0A1S4DXM3_CUCME; NAC domain-containing protein 40 | ||||
STRING | XP_004170400.1 | 1e-105 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7315 | 33 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G27300.1 | 3e-75 | NTM1-like 8 |
Publications ? help Back to Top | |||
---|---|---|---|
|