PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C007400P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 85aa MW: 9865.66 Da PI: 11.9675 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 98.8 | 3.9e-31 | 28 | 77 | 2 | 51 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 prlrWtp+LH++Fv+ave+LGG+e+AtPk +l++m+v+gLt++hvkSHLQ MELO3C007400P1 28 PRLRWTPDLHRCFVHAVERLGGEERATPKMVLQIMNVNGLTISHVKSHLQ 77 8************************************************* PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.363 | 24 | 84 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.8E-29 | 24 | 77 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.38E-14 | 26 | 78 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.3E-23 | 28 | 78 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 7.0E-8 | 29 | 77 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MRVSRQRVFH DINFKSPMVR PYVRSKMPRL RWTPDLHRCF VHAVERLGGE ERATPKMVLQ 60 IMNVNGLTIS HVKSHLQVQI GSFL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4r_A | 2e-20 | 29 | 77 | 3 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 2e-20 | 29 | 77 | 3 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 2e-20 | 29 | 77 | 3 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 2e-20 | 29 | 77 | 3 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681875 | 7e-81 | LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007. | |||
GenBank | LN713262 | 7e-81 | LN713262.1 Cucumis melo genomic chromosome, chr_8. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004134975.2 | 1e-48 | PREDICTED: probable transcription factor KAN2 isoform X1 | ||||
Refseq | XP_016899272.1 | 2e-48 | PREDICTED: probable transcription factor KAN2 isoform X1 | ||||
Swissprot | Q700D9 | 1e-27 | MYBF_ARATH; Putative Myb family transcription factor At1g14600 | ||||
TrEMBL | A0A0A0KHB7 | 4e-50 | A0A0A0KHB7_CUCSA; Uncharacterized protein | ||||
STRING | XP_008439998.1 | 3e-51 | (Cucumis melo) | ||||
STRING | XP_004155673.1 | 2e-51 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF9381 | 28 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02060.1 | 2e-32 | G2-like family protein |