PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C003686P2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 192aa MW: 21034.8 Da PI: 10.4614 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 44.3 | 3.9e-14 | 79 | 138 | 1 | 60 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 eke+kr +r+ +NR++A+ R+RKk ++ eLee++ +Le+ N++L ++l++l++e + l+ MELO3C003686P2 79 EKESKRLKRLLRNRVSAQQARERKKVYLSELEERATNLEKRNSELEEKLSTLQNENQMLR 138 89*****************************************************99764 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00041 | 9.6E-5 | 78 | 94 | IPR001630 | cAMP response element binding (CREB) protein |
Pfam | PF00170 | 5.0E-12 | 79 | 138 | IPR004827 | Basic-leucine zipper domain |
SMART | SM00338 | 3.6E-11 | 79 | 143 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 12.07 | 81 | 138 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 3.9E-15 | 83 | 140 | No hit | No description |
SuperFamily | SSF57959 | 4.94E-12 | 83 | 139 | No hit | No description |
CDD | cd14704 | 8.17E-20 | 84 | 135 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 86 | 101 | IPR004827 | Basic-leucine zipper domain |
PRINTS | PR00041 | 9.6E-5 | 96 | 116 | IPR001630 | cAMP response element binding (CREB) protein |
PRINTS | PR00041 | 9.6E-5 | 116 | 133 | IPR001630 | cAMP response element binding (CREB) protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 192 aa Download sequence Send to blast |
MQGRAAAAAI SRMRSSSERS SSSAFQLDVK EDIGAESDEE EISRVPQICG NSGSTVGISA 60 PGKAPASDSV RSRGRSAAEK ESKRLKRLLR NRVSAQQARE RKKVYLSELE ERATNLEKRN 120 SELEEKLSTL QNENQMLRHV RQTKPSPLAL FVNIFVHDGS NIDPKASTSS ILVLMPLASI 180 VVNIYVLNLR T* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681824 | 1e-178 | LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596. | |||
GenBank | LN713258 | 1e-178 | LN713258.1 Cucumis melo genomic chromosome, chr_4. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008466392.1 | 5e-94 | PREDICTED: transcription factor HY5 | ||||
Swissprot | Q9SM50 | 4e-38 | HY5_SOLLC; Transcription factor HY5 | ||||
TrEMBL | A0A1S3CSG2 | 1e-92 | A0A1S3CSG2_CUCME; transcription factor HY5 | ||||
STRING | XP_008466392.1 | 2e-93 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF7064 | 32 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11260.1 | 2e-39 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|