PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C002055P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 153aa MW: 16939.8 Da PI: 9.0772 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 115.3 | 2.6e-36 | 11 | 68 | 5 | 62 |
zf-Dof 5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 + +cprC+s +tkfCyynny+ sqPr+fCk+CrryWt GG lrnvPvGgg+rk+kk+s MELO3C002055P1 11 KCRCPRCNSLHTKFCYYNNYNYSQPRHFCKTCRRYWTLGGLLRNVPVGGGSRKSKKNS 68 578***************************************************9976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02701 | 5.0E-31 | 12 | 66 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.006 | 12 | 66 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 3.0E-18 | 13 | 57 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 14 | 50 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MDSQSKPDEL KCRCPRCNSL HTKFCYYNNY NYSQPRHFCK TCRRYWTLGG LLRNVPVGGG 60 SRKSKKNSKP KRATFTDSAC NSNSGVIGSD LDMRSSPLKL NQSGDSPWNG REFEAGDPAA 120 EEGFGLDHLA TSSGDSGSSW LKFYGLTHHF NN* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681932 | 0.0 | LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001. | |||
GenBank | LN713266 | 0.0 | LN713266.1 Cucumis melo genomic chromosome, chr_12. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008445935.1 | 1e-111 | PREDICTED: dof zinc finger protein DOF3.4-like | ||||
Swissprot | Q9FGD6 | 6e-29 | DOF58_ARATH; Dof zinc finger protein DOF5.8 | ||||
TrEMBL | A0A1S3BDV3 | 1e-109 | A0A1S3BDV3_CUCME; dof zinc finger protein DOF3.4-like | ||||
STRING | XP_008445935.1 | 1e-110 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF21361 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G51700.1 | 1e-25 | DOF zinc finger protein 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|