PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla015138 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 127aa MW: 15013.5 Da PI: 11.7147 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 28.4 | 3.7e-09 | 1 | 42 | 10 | 51 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 +q+NRe+ArrsR +K+++ + L+ +v L+ N++ + +++ Cla015138 1 MQSNRESARRSRMKKQKQFQDLTSEVRRLQIVNSRIVESVNS 42 79****************************999888777665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 9.1E-7 | 1 | 44 | No hit | No description |
SMART | SM00338 | 0.0082 | 1 | 59 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.1E-6 | 1 | 42 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 8.50E-11 | 1 | 46 | No hit | No description |
SuperFamily | SSF57959 | 5.2E-8 | 1 | 45 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 127 aa Download sequence Send to blast |
MQSNRESARR SRMKKQKQFQ DLTSEVRRLQ IVNSRIVESV NSREQARIEI ETMNNLLRVE 60 AMETTYRLKA LDLVLQIVDK ANALAVGVRD PLLEPWQLTS KGSCRRRRRI TIRFFFNAVL 120 FLTCRIF |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008451653.1 | 9e-49 | PREDICTED: bZIP transcription factor 53-like | ||||
TrEMBL | A0A1S3BS27 | 2e-47 | A0A1S3BS27_CUCME; bZIP transcription factor 53-like | ||||
STRING | XP_008451653.1 | 4e-48 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF24718 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G62420.1 | 1e-21 | basic region/leucine zipper motif 53 |