PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla015118 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 149aa MW: 15985.5 Da PI: 9.3912 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 60 | 3e-19 | 56 | 89 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 C++C+tt TplWR gp g+++LCnaCG++yrk++ Cla015118 56 CVHCRTTRTPLWRAGPAGPRSLCNACGIRYRKTK 89 ********************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 3.18E-14 | 48 | 94 | No hit | No description |
PROSITE profile | PS50114 | 12.809 | 50 | 86 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.1E-13 | 50 | 100 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.9E-15 | 54 | 91 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 3.96E-15 | 55 | 87 | No hit | No description |
Pfam | PF00320 | 5.4E-17 | 56 | 89 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 56 | 81 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MLKAEVIGDL GLDPSIMAFL MNCSADLSAS TFNPSLMPDA SKQSLLNMEP QKQRACVHCR 60 TTRTPLWRAG PAGPRSLCNA CGIRYRKTKN NNNNSNGGVN NKMGKGKKVG EGSLKVRVVS 120 LGREIVEEAI GEEEQAAAML LMALSSGYV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011659382.1 | 9e-57 | PREDICTED: GATA transcription factor 15-like | ||||
Swissprot | Q9FJ10 | 2e-21 | GAT16_ARATH; GATA transcription factor 16 | ||||
TrEMBL | A0A0A0K6B1 | 2e-55 | A0A0A0K6B1_CUCSA; Uncharacterized protein | ||||
STRING | XP_008451515.1 | 2e-55 | (Cucumis melo) | ||||
STRING | XP_004136159.1 | 8e-53 | (Cucumis sativus) | ||||
STRING | XP_004162445.1 | 8e-53 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1569 | 32 | 98 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 2e-14 | GATA transcription factor 23 |
Publications ? help Back to Top | |||
---|---|---|---|
|