PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla014105 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 247aa MW: 28131.1 Da PI: 8.6615 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.1 | 2.3e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +i+n + rqvtfskRr g++KKA+ELSvLCda+va+iifs tgkl+eyss Cla014105 10 KIDNATARQVTFSKRRRGLFKKAKELSVLCDADVALIIFSATGKLFEYSS 59 69**********************************************96 PP | |||||||
2 | K-box | 50.8 | 7.1e-18 | 91 | 172 | 18 | 99 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + ++++L+kei +++R++ Ge+L++L+++eLq+Le+ Le++l+++ +kK e ++++i +lq+k el +enk+L+++ e Cla014105 91 NSNYTRLNKEIADKTHQLRQMRGEELQTLNIEELQKLEKSLESGLSRVMEKKGERIMKEITDLQRKSAELMDENKRLKQQAE 172 56799*************************************************************************9976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.829 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.0E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.63E-39 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 8.11E-31 | 3 | 85 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.0E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.045 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 3.9E-16 | 92 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 247 aa Download sequence Send to blast |
MAKEKIQIRK IDNATARQVT FSKRRRGLFK KAKELSVLCD ADVALIIFSA TGKLFEYSSS 60 SMKGIIERHN LHSKNLQKLE QPSLELQLVE NSNYTRLNKE IADKTHQLRQ MRGEELQTLN 120 IEELQKLEKS LESGLSRVME KKGERIMKEI TDLQRKSAEL MDENKRLKQQ AEKMNAVRHL 180 GVDPEILVVE DGQSSNSVTE AGVSNSNGPP QDLESSDTSL KLGYPHCMKI DFTLFSSNVY 240 LDWSSFV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 4e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 4e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 4e-19 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681875 | 6e-87 | LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007. | |||
GenBank | LN713262 | 6e-87 | LN713262.1 Cucumis melo genomic chromosome, chr_8. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004143442.1 | 1e-157 | PREDICTED: MADS-box protein SVP-like isoform X1 | ||||
Refseq | XP_008440538.1 | 1e-157 | PREDICTED: MADS-box protein SVP-like | ||||
Refseq | XP_008440540.1 | 1e-157 | PREDICTED: MADS-box protein SVP-like | ||||
Refseq | XP_011657947.1 | 1e-157 | PREDICTED: MADS-box protein SVP-like isoform X1 | ||||
Swissprot | Q9FVC1 | 1e-109 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A1S3B1C2 | 1e-155 | A0A1S3B1C2_CUCME; MADS-box protein SVP-like | ||||
STRING | XP_008440538.1 | 1e-156 | (Cucumis melo) | ||||
STRING | XP_004143442.1 | 1e-156 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF890 | 33 | 106 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-100 | MIKC_MADS family protein |