PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.6845s0027.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 184aa MW: 21313.4 Da PI: 6.3051 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 47.7 | 3.4e-15 | 74 | 131 | 5 | 62 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 +++rr+ +NRe+ArrsR RK+ ++eL v+ L +eN++L ++l++ ++ + + +e Cagra.6845s0027.1.p 74 RKQRRMVSNRESARRSRMRKQRHLDELMSQVAWLRSENHQLLDKLNQVSDSNDHVVQE 131 689********************************************99988766655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.1E-15 | 70 | 134 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.001 | 72 | 135 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 4.0E-12 | 73 | 127 | No hit | No description |
Pfam | PF00170 | 5.2E-13 | 74 | 130 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.81E-13 | 74 | 124 | No hit | No description |
CDD | cd14702 | 7.82E-19 | 75 | 122 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 77 | 92 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MQPNYDSLSL NNMQQQDYFH LNNYYNNLTP STNNNLNLLQ YPQIHQELNL QSPASNNSTT 60 SDDATEGIFV INERKQRRMV SNRESARRSR MRKQRHLDEL MSQVAWLRSE NHQLLDKLNQ 120 VSDSNDHVVQ ENLNLKEENL ELRQVITSMK KLGGGIHEKY PSSSSMDEDF SSITDDPRSH 180 HPS* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 86 | 93 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00512 | DAP | Transfer from AT5G15830 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.6845s0027.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK117828 | 0.0 | AK117828.1 Arabidopsis thaliana At5g15830 mRNA for putative bZIP transcription factor AtbZip3, complete cds, clone: RAFL18-02-O03. | |||
GenBank | AL391144 | 0.0 | AL391144.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F14F8 (ESSA project). | |||
GenBank | BT003683 | 0.0 | BT003683.1 Arabidopsis thaliana At5g15830 mRNA, complete cds. | |||
GenBank | CP002688 | 0.0 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006288751.1 | 1e-131 | basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 5e-33 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | R0GXL9 | 1e-130 | R0GXL9_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.6845s0027.1.p | 1e-131 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10632 | 15 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15830.1 | 7e-82 | basic leucine-zipper 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.6845s0027.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|