PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.15822s0014.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 190aa MW: 20469.5 Da PI: 6.7955 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 185.7 | 3.6e-58 | 26 | 121 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 reqdrflPianvsrimkk+lPanakiskdaket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++ Cagra.15822s0014.1.p 26 REQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRF 114 89*************************************************************************************** PP NF-YB 91 relegek 97 re+ege+ Cagra.15822s0014.1.p 115 REIEGER 121 *****97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.4E-54 | 20 | 135 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.71E-41 | 28 | 138 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.1E-28 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.2E-21 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.2E-21 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 7.2E-21 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MGDSDRDSGG GQNGNNQNGQ SSLSPREQDR FLPIANVSRI MKKALPANAK ISKDAKETMQ 60 ECVSEFISFV TGEASDKCQK EKRKTINGDD LLWAMTTLGF EDYVEPLKVY LQRFREIEGE 120 RTGLGRPQTA AEAGEHQRDA VGDAGGFYGA GGMQYHQHHQ FLHQQNHMYG ATGGGSNGGG 180 GAASGRTRT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-48 | 26 | 116 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-48 | 26 | 116 | 2 | 92 | Transcription factor HapC (Eurofung) |
5g49_A | 2e-48 | 21 | 116 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.15822s0014.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB025628 | 0.0 | AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7. | |||
GenBank | AF385744 | 0.0 | AF385744.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds. | |||
GenBank | AY078026 | 0.0 | AY078026.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds. | |||
GenBank | CP002688 | 0.0 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006282223.1 | 1e-139 | nuclear transcription factor Y subunit B-2 | ||||
Swissprot | Q9FGJ3 | 8e-87 | NFYB2_ARATH; Nuclear transcription factor Y subunit B-2 | ||||
TrEMBL | R0F1G8 | 1e-138 | R0F1G8_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.15822s0014.1.p | 1e-139 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47640.1 | 8e-83 | nuclear factor Y, subunit B2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.15822s0014.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|