PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc11_g17410 | ||||||||
Common Name | GSCOC_T00038308001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 279aa MW: 30748.2 Da PI: 9.697 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 155.6 | 2.1e-48 | 14 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 lppGfrFhPtdeelvv+yLk+k+ + +l++ ++i+evd++k++PwdLp e+e yfFskr+ ky++g+r+nrat sgyWkatg dk++++ +++ Cc11_g17410 14 LPPGFRFHPTDEELVVQYLKRKALSCPLPA-SIIPEVDVCKSDPWDLPGD---LERERYFFSKREVKYRSGNRSNRATGSGYWKATGVDKQIVACRSR 107 79****************************.89***************44...46899***********************************97444 PP NAM 99 l.....vglkktLvfykgrapkgektdWvmheyrl 128 l g+kktLvfy+g+ p+g +tdWvmheyrl Cc11_g17410 108 LgvggvGGVKKTLVFYRGKPPNGIRTDWVMHEYRL 142 45555599*************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.7E-56 | 10 | 172 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.3 | 14 | 172 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.0E-26 | 15 | 142 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 279 aa Download sequence Send to blast |
MEKLNFVKNG VLRLPPGFRF HPTDEELVVQ YLKRKALSCP LPASIIPEVD VCKSDPWDLP 60 GDLERERYFF SKREVKYRSG NRSNRATGSG YWKATGVDKQ IVACRSRLGV GGVGGVKKTL 120 VFYRGKPPNG IRTDWVMHEY RLVNVVEAAA PISPLQNKSA QESWVLCRIF LKRRSGKSSE 180 DEVTESSLPN CTAAAPPPLG GKMNGVVVFY DFLGKDTREL NPGATISSSS GCSGITEISC 240 NEAEDMEESS SCTTASSMLG KKKPRERIHQ PRKFGRSV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-47 | 12 | 177 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-47 | 12 | 177 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-47 | 12 | 177 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-47 | 12 | 177 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-47 | 12 | 177 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 2e-47 | 12 | 177 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 2e-47 | 12 | 177 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 2e-47 | 12 | 177 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 2e-47 | 12 | 177 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 2e-47 | 12 | 177 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 2e-47 | 12 | 177 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 2e-47 | 12 | 177 | 18 | 173 | NAC domain-containing protein 19 |
4dul_A | 2e-47 | 12 | 177 | 15 | 170 | NAC domain-containing protein 19 |
4dul_B | 2e-47 | 12 | 177 | 15 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00507 | DAP | Transfer from AT5G13180 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027097354.1 | 0.0 | NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 4e-83 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A068UXX1 | 0.0 | A0A068UXX1_COFCA; Uncharacterized protein | ||||
STRING | cassava4.1_014491m | 1e-107 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1387 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 5e-83 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|