PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc09_g08300 | ||||||||
Common Name | GSCOC_T00020776001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 181aa MW: 19973.4 Da PI: 8.4692 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 106.6 | 1.2e-33 | 9 | 67 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s+fprsYYrCts++C vkk+vers+ dp++v++tYeg+H h+ Cc09_g08300 9 LDDGYRWRKYGQKAVKNSPFPRSYYRCTSPSCGVKKRVERSSGDPTTVVTTYEGTHMHP 67 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.1E-32 | 2 | 69 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.27E-29 | 3 | 69 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.777 | 4 | 69 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.1E-38 | 9 | 68 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.3E-26 | 10 | 67 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MTKSEVDHLD DGYRWRKYGQ KAVKNSPFPR SYYRCTSPSC GVKKRVERSS GDPTTVVTTY 60 EGTHMHPTPL TSRGSLGLVP ESSASSGSGP GPSSFFPAPM SQYHHQQPQQ FQQQQLQLLP 120 FFRVPTAPAS LHFNTPSSSF AHMIVQESSY CPPPPSSFVD NGLLEDIVPS EMLIKEPKKE 180 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-31 | 2 | 69 | 10 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 5e-31 | 2 | 69 | 10 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JN609590 | 1e-37 | JN609590.1 Gossypium hirsutum WRKY48 mRNA, complete cds. | |||
GenBank | JQ081266 | 1e-37 | JQ081266.1 Gossypium hirsutum WRKY5 transcription factor (WRKY5) mRNA, complete cds. | |||
GenBank | KF669855 | 1e-37 | KF669855.1 Gossypium hirsutum WRKY transcription factor 95 (WRKY95) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027115874.1 | 8e-85 | WRKY transcription factor 23-like | ||||
Swissprot | O22900 | 4e-43 | WRK23_ARATH; WRKY transcription factor 23 | ||||
TrEMBL | A0A068UBJ0 | 1e-129 | A0A068UBJ0_COFCA; Uncharacterized protein | ||||
STRING | EOY06768 | 1e-55 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1309 | 24 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47260.1 | 1e-40 | WRKY DNA-binding protein 23 |
Publications ? help Back to Top | |||
---|---|---|---|
|