PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc06_g19040 | ||||||||
Common Name | GSCOC_T00028952001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 162aa MW: 17682.8 Da PI: 9.4228 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 72.2 | 9.7e-23 | 80 | 138 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl k+y+i++++e++++isws++g+sf+v+d+++f +vL kyF+h+nfaSF+ QLn+Y Cc06_g19040 80 FLLKVYDIVKNPETESIISWSSSGTSFIVWDPHRFVAEVLGKYFRHNNFASFICQLNTY 138 9********************************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 6.5E-25 | 71 | 140 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 1.6E-20 | 76 | 159 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 2.18E-21 | 78 | 139 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 1.0E-12 | 80 | 103 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 9.7E-20 | 80 | 139 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.0E-12 | 118 | 130 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.0E-12 | 131 | 143 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MEANQETSEV TNSTKYELKN GENEGERLNP TIPMGTDVSE SSSNAIVTAA TAVSATPLAK 60 EGYANGASSS SSRVRAPPPF LLKVYDIVKN PETESIISWS SSGTSFIVWD PHRFVAEVLG 120 KYFRHNNFAS FICQLNTYVK RSIGIDWNSR MRGSKKGRRV G* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 8e-18 | 78 | 143 | 27 | 92 | Heat shock factor protein 1 |
5d5v_B | 8e-18 | 78 | 143 | 27 | 92 | Heat shock factor protein 1 |
5d5v_D | 8e-18 | 78 | 143 | 27 | 92 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269|PubMed:16202242}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:16202242}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027174269.1 | 2e-68 | heat stress transcription factor A-2d-like | ||||
Swissprot | Q338B0 | 2e-24 | HFA2C_ORYSJ; Heat stress transcription factor A-2c | ||||
TrEMBL | A0A068UPI1 | 1e-115 | A0A068UPI1_COFCA; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA16030 | 2 | 6 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G17750.1 | 1e-17 | heat shock factor 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|