PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc06_g04470 | ||||||||
Common Name | GSCOC_T00042956001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 118aa MW: 13950 Da PI: 10.7126 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.4 | 1.2e-16 | 8 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W +eEde+l+ av lG ++W + a+ g++R++ +c++rw +yl Cc06_g04470 8 KGPWLEEEDERLIAAVSILGERRWGSLAKASGLRRSGRSCRLRWMNYL 55 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 57.2 | 3.8e-18 | 64 | 106 | 4 | 48 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 T+eE+ l+++++kq+G++ W++Iar ++ gRt++++k++w+++l Cc06_g04470 64 ITEEEEHLIIQLHKQWGNR-WSRIARSLP-GRTDNEIKNYWRTHL 106 69*****************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.395 | 1 | 55 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.35E-29 | 6 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-13 | 7 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.6E-14 | 8 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-21 | 9 | 62 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.33E-8 | 10 | 55 | No hit | No description |
PROSITE profile | PS51294 | 27.183 | 56 | 110 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-15 | 60 | 108 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-25 | 63 | 109 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.8E-16 | 64 | 106 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.79E-11 | 65 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MQEAEMRKGP WLEEEDERLI AAVSILGERR WGSLAKASGL RRSGRSCRLR WMNYLRPNLK 60 HGHITEEEEH LIIQLHKQWG NRWSRIARSL PGRTDNEIKN YWRTHLRKKA LILEEGL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 9e-30 | 4 | 110 | 23 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00406 | DAP | Transfer from AT3G53200 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027069326.1 | 1e-78 | myb-related protein MYBAS1-like | ||||
Swissprot | Q9SCP1 | 9e-53 | MYB27_ARATH; Transcription factor MYB27 | ||||
TrEMBL | A0A068V3D2 | 1e-77 | A0A068V3D2_COFCA; Uncharacterized protein | ||||
STRING | Solyc09g008390.1.1 | 3e-63 | (Solanum lycopersicum) | ||||
STRING | XP_009625011.1 | 5e-63 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53200.1 | 3e-44 | myb domain protein 27 |
Publications ? help Back to Top | |||
---|---|---|---|
|