PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc01_g13880
Common NameGSCOC_T00028370001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family MYB_related
Protein Properties Length: 287aa    MW: 32050 Da    PI: 9.7388
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc01_g13880genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-14131175347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
      Cc01_g13880 131 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 175
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.2682075IPR017884SANT domain
SMARTSM007171.6E-92173IPR001005SANT/Myb domain
SuperFamilySSF466897.18E-122378IPR009057Homeodomain-like
CDDcd001672.99E-72471No hitNo description
Gene3DG3DSA:1.10.10.607.5E-13122180IPR009057Homeodomain-like
PROSITE profilePS5129420.728124180IPR017930Myb domain
SuperFamilySSF466896.28E-17125179IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-17127179IPR006447Myb domain, plants
SMARTSM007173.2E-13128178IPR001005SANT/Myb domain
CDDcd001671.56E-11131176No hitNo description
PfamPF002494.9E-13131175IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MEILPPASYL SNSGWLVEES KSTKWTPAEN KAFENALAVF DKDTPDRWQK VAAVVPGKTV  60
MDVIRQYKEL VEDVSNIEAG LIPIPGYGTS PFTLEWGSGH NFDGYKQSFI ATGKRSSATR  120
PSEQERKKGV PWTEEEHKLF LMGLKKYGKG DWRNISRNFV ITRTPTQVAS HAQKYFIRQL  180
SGGKDKRRAS IHDITTVNLS DNQIPSPDRK KSSSPDTSNW NQGNSNGAVM NFNMGHGNIF  240
MPPHGVNSCD LKMQGQDLQR GGMHNSYVGS QNMVFQMQST HQYPHA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-1925901176RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00568DAPTransfer from AT5G58900Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027110574.10.0transcription factor DIVARICATA-like isoform X1
SwissprotQ8S9H71e-143DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068UL310.0A0A068UL31_COFCA; Uncharacterized protein
STRINGVIT_06s0004g06100.t011e-149(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-106MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]