PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10032304m | ||||||||
Common Name | CICLE_v10032304mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 287aa MW: 33067 Da PI: 6.948 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 175.8 | 1.3e-54 | 9 | 134 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrFhPtdeel+v+yL+++++++++++ ++i+evdiyk++Pw+Lp+k++ +ekewyfFs+rd+ky++g+r+nrat sgyWkatg+dk+++ Ciclev10032304m 9 LPPGFRFHPTDEELIVHYLRNQATSRPCPV-SIIPEVDIYKFDPWQLPEKAEFGEKEWYFFSPRDRKYPNGTRPNRATVSGYWKATGTDKAIYG 101 79****************************.89***************99999***************************************** PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ g+kk Lvfykgr pkg ktdW+mheyrl Ciclev10032304m 102 -GSKYLGVKKALVFYKGRPPKGIKTDWIMHEYRL 134 .999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.72E-67 | 4 | 161 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 61.673 | 9 | 161 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.2E-27 | 10 | 134 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009825 | Biological Process | multidimensional cell growth | ||||
GO:0009835 | Biological Process | fruit ripening | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 287 aa Download sequence Send to blast |
MEAQASTELP PGFRFHPTDE ELIVHYLRNQ ATSRPCPVSI IPEVDIYKFD PWQLPEKAEF 60 GEKEWYFFSP RDRKYPNGTR PNRATVSGYW KATGTDKAIY GGSKYLGVKK ALVFYKGRPP 120 KGIKTDWIMH EYRLNDPTRQ PYKHNGSMKL DDWVLCRIYK KRQTGSRSVL DAKVEEDQSC 180 VDQLGKTGGY VEHANASDEQ KLMVKFPRTC SLAHLVELEY FAPISQLLND NTYNFNYDFQ 240 NGINNNAASD DQFENKLQPS DMHQVNHSDS LNQQSLFVNP TVYEFQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-73 | 9 | 167 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-73 | 9 | 167 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-73 | 9 | 167 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-73 | 9 | 167 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 9e-74 | 9 | 167 | 20 | 174 | NAC domain-containing protein 19 |
3swm_B | 9e-74 | 9 | 167 | 20 | 174 | NAC domain-containing protein 19 |
3swm_C | 9e-74 | 9 | 167 | 20 | 174 | NAC domain-containing protein 19 |
3swm_D | 9e-74 | 9 | 167 | 20 | 174 | NAC domain-containing protein 19 |
3swp_A | 9e-74 | 9 | 167 | 20 | 174 | NAC domain-containing protein 19 |
3swp_B | 9e-74 | 9 | 167 | 20 | 174 | NAC domain-containing protein 19 |
3swp_C | 9e-74 | 9 | 167 | 20 | 174 | NAC domain-containing protein 19 |
3swp_D | 9e-74 | 9 | 167 | 20 | 174 | NAC domain-containing protein 19 |
4dul_A | 1e-73 | 9 | 167 | 17 | 171 | NAC domain-containing protein 19 |
4dul_B | 1e-73 | 9 | 167 | 17 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ccl.3318 | 0.0 | fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00221 | DAP | Transfer from AT1G69490 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF185419 | 0.0 | EF185419.1 Citrus sinensis NAC domain protein (NAC) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006438726.1 | 0.0 | NAC transcription factor 29 | ||||
Refseq | XP_015387126.1 | 0.0 | NAC transcription factor 29 isoform X1 | ||||
Swissprot | K4BWV2 | 1e-120 | NAP1_SOLLC; NAC domain-containing protein 1 | ||||
TrEMBL | A0A067GTM1 | 0.0 | A0A067GTM1_CITSI; Uncharacterized protein | ||||
TrEMBL | V4TQ33 | 0.0 | V4TQ33_9ROSI; Uncharacterized protein | ||||
STRING | XP_006438726.1 | 0.0 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7707 | 26 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 1e-115 | NAC-like, activated by AP3/PI |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10032304m |
Entrez Gene | 18043968 |
Publications ? help Back to Top | |||
---|---|---|---|
|